eF-site ID 1l9o-A PDB Code 1l9o Chain A click to enlarge Title CRYSTAL STRUCTURE OF NITRITE SOAKED I257A VARIANT OF THE COPPER-CONTAINING NITRITE REDUCTASE FROM ALCALIGENES FAECALIS Classification OXIDOREDUCTASE Compound COPPER-CONTAINING NITRITE REDUCTASE Source Alcaligenes faecalis (NIR_ALCFA) Sequence A:  ATAAEIAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTM VIEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLEL TLINPETNTLMHNIDFHAATGALGGGGLTEINPGEKTILR FKATKPGVFVYHCAPPGMVPWHVVSGMNGAIMVLPREGLH DGKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAY EDTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLI VHSQANRDTRPHLAGGHGDYVWATGKFNTPPDVDQETWFI PGGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVT GEWNDDLMTSVLAPSG Description Functional site 1) chain A residue 95 type sequence H description BINDING SITE FOR RESIDUE CU A 501 source : AC1 2) chain A residue 136 type sequence C description BINDING SITE FOR RESIDUE CU A 501 source : AC1 3) chain A residue 145 type sequence H description BINDING SITE FOR RESIDUE CU A 501 source : AC1 4) chain A residue 150 type sequence M description BINDING SITE FOR RESIDUE CU A 501 source : AC1 5) chain A residue 100 type sequence H description BINDING SITE FOR RESIDUE CU A 502 source : AC2 6) chain A residue 135 type sequence H description BINDING SITE FOR RESIDUE CU A 502 source : AC2 7) chain A residue 135 type sequence H description BINDING SITE FOR RESIDUE NO2 B 504 source : AC3 8) chain A residue 255 type sequence H description BINDING SITE FOR RESIDUE CU C 502 source : AC8 9) chain A residue 306 type sequence H description BINDING SITE FOR RESIDUE CU C 502 source : AC8 10) chain A residue 255 type sequence H description BINDING SITE FOR RESIDUE NO2 A 704 source : AC9 11) chain A residue 257 type sequence A description BINDING SITE FOR RESIDUE NO2 A 704 source : AC9 12) chain A residue 306 type sequence H description BINDING SITE FOR RESIDUE NO2 A 704 source : AC9 13) chain A residue 95 type BINDING sequence H description type 1 copper site => ECO:0000269|PubMed:8172899 source Swiss-Prot : SWS_FT_FI1 14) chain A residue 100 type BINDING sequence H description type 2 copper site source Swiss-Prot : SWS_FT_FI2 15) chain A residue 135 type BINDING sequence H description type 2 copper site source Swiss-Prot : SWS_FT_FI2 16) chain A residue 136 type BINDING sequence C description type 1 copper site source Swiss-Prot : SWS_FT_FI3 17) chain A residue 145 type BINDING sequence H description type 1 copper site source Swiss-Prot : SWS_FT_FI3 18) chain A residue 150 type BINDING sequence M description type 1 copper site source Swiss-Prot : SWS_FT_FI3 19) chain A residue 306 type BINDING sequence H description type 2 copper site => ECO:0000269|PubMed:8172899 source Swiss-Prot : SWS_FT_FI4

Display surface Download Links