eF-site ID 1l89-A PDB Code 1l89 Chain A click to enlarge Title SIMILAR HYDROPHOBIC REPLACEMENTS OF LEU 99 AND PHE 153 WITHIN THE CORE OF T4 LYSOZYME HAVE DIFFERENT STRUCTURAL AND THERMODYNAMIC CONSEQUENCES Classification HYDROLASE(O-GLYCOSYL) Compound T4 LYSOZYME Source Enterobacteria phage T4 (Bacteriophage T4) (LYCV_BPT4) Sequence A:  MNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLN AAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILR NAKLKPVYDSLDAVRRAAAINMVFQMGETGVAGFTNSLRM LQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTARTGTWDA YK Description Functional site 1) chain A residue 124 type sequence K description BINDING SITE FOR RESIDUE CL A 173 source : AC1 2) chain A residue 142 type sequence T description BINDING SITE FOR RESIDUE CL A 173 source : AC1 3) chain A residue 144 type sequence N description BINDING SITE FOR RESIDUE CL A 173 source : AC1 4) chain A residue 145 type sequence R description BINDING SITE FOR RESIDUE CL A 173 source : AC1 5) chain A residue 135 type sequence K description BINDING SITE FOR RESIDUE CL A 178 source : AC2 6) chain A residue 75 type sequence V description BINDING SITE FOR RESIDUE BME A 901 source : AC3 7) chain A residue 93 type sequence A description BINDING SITE FOR RESIDUE BME A 902 source : AC4 8) chain A residue 11 type catalytic sequence E description 921 source MCSA : MCSA1 9) chain A residue 20 type catalytic sequence D description 921 source MCSA : MCSA1 10) chain A residue 32 type BINDING sequence L description BINDING => ECO:0000269|PubMed:8266098 source Swiss-Prot : SWS_FT_FI3 11) chain A residue 104 type BINDING sequence F description BINDING => ECO:0000269|PubMed:8266098 source Swiss-Prot : SWS_FT_FI3 12) chain A residue 117 type BINDING sequence S description BINDING => ECO:0000303|PubMed:7831309 source Swiss-Prot : SWS_FT_FI4 13) chain A residue 132 type BINDING sequence N description BINDING => ECO:0000303|PubMed:7831309 source Swiss-Prot : SWS_FT_FI4 14) chain A residue 11 type ACT_SITE sequence E description Proton donor/acceptor => ECO:0000255|HAMAP-Rule:MF_04110, ECO:0000269|PubMed:3382407, ECO:0000269|PubMed:7831309, ECO:0000269|PubMed:8266098 source Swiss-Prot : SWS_FT_FI1 15) chain A residue 20 type ACT_SITE sequence D description Proton donor/acceptor => ECO:0000255|HAMAP-Rule:MF_04110, ECO:0000269|PubMed:1892846, ECO:0000269|PubMed:3382407, ECO:0000269|PubMed:7831309, ECO:0000269|PubMed:8266098 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links