eF-site ID 1l0a-AB
PDB Code 1l0a
Chain A, B

click to enlarge
Title DOWNSTREAM REGULATOR TANK BINDS TO THE CD40 RECOGNITION SITE ON TRAF3
Classification SIGNALING PROTEIN
Compound TNF receptor associated factor 3
Source Homo sapiens (Human) (TANK_HUMAN)
Sequence A:  NTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNG
VLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCA
RVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTL
MLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPV
FVAQTVLENGTYIKDDTIFIKVIVDTSDLPDP
B:  SVPIQCTDKTDKQEALFK
Description (1)  TNF receptor associated factor 3, TRAF family member-associated NF-kappa-b activator

Display surface

Download
Links