eF-site ID 1kzy-A PDB Code 1kzy Chain A click to enlarge Title Crystal Structure of the 53bp1 BRCT Region Complexed to Tumor Suppressor P53 Classification DNA BINDING PROTEIN, PROTEIN BINDING Compound CELLULAR TUMOR ANTIGEN P53 Source null (TP53B_HUMAN) Sequence A:  SSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMF CQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVR RCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRH SVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTI ITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENL Description (1)  CELLULAR TUMOR ANTIGEN P53, TUMOR REPRESSOR P53-BINDING PROTEIN 1 Functional site 1) chain A residue 176 type sequence C description BINDING SITE FOR RESIDUE ZN A 1 source : AC1 2) chain A residue 179 type sequence H description BINDING SITE FOR RESIDUE ZN A 1 source : AC1 3) chain A residue 238 type sequence C description BINDING SITE FOR RESIDUE ZN A 1 source : AC1 4) chain A residue 242 type sequence C description BINDING SITE FOR RESIDUE ZN A 1 source : AC1 5) chain A residue 120 type MOD_RES sequence K description N6-acetyllysine; by KAT6A => ECO:0000269|PubMed:23431171 source Swiss-Prot : SWS_FT_FI3 6) chain A residue 183 type MOD_RES sequence S description Phosphoserine; by AURKB => ECO:0000269|PubMed:20959462 source Swiss-Prot : SWS_FT_FI4 7) chain A residue 269 type MOD_RES sequence S description Phosphoserine; by AURKB => ECO:0000269|PubMed:20959462 source Swiss-Prot : SWS_FT_FI4 8) chain A residue 284 type MOD_RES sequence T description Phosphothreonine; by AURKB => ECO:0000269|PubMed:20959462 source Swiss-Prot : SWS_FT_FI5 9) chain A residue 238 type MOD_RES sequence C description Phosphoserine => ECO:0007744|PubMed:18669648 source Swiss-Prot : SWS_FT_FI1 10) chain A residue 242 type MOD_RES sequence C description Phosphoserine => ECO:0007744|PubMed:18669648 source Swiss-Prot : SWS_FT_FI1 11) chain A residue 237-249 type prosite sequence MCNSSCMGGMNRR description P53 p53 family signature. MCNSSCMGGMNRR source prosite : PS00348

Display surface Download Links