eF-site ID 1kx5-E PDB Code 1kx5 Chain E click to enlarge Title X-Ray Structure of the Nucleosome Core Particle, NCP147, at 1.9 A Resolution Classification STRUCTURAL PROTEIN/DNA Compound DNA (5'(ATCAATATCCACCTGCAGATACTACCAAAAGTGTATTTGGAAACTGCTCCATCAAAAGGCATGTTCAGCTGGAATCCAGCTGAACATGCCTTTTGATGGAGCAGTTTCCAAATACACTTTTGGTAGTATCTGCAGGTGGATATTGAT)3') Source Bos taurus (Bovine) (1KX5) Sequence E:  ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR YRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT DLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIM PKDIQLARRIRGERA Description Functional site 1) chain E residue 77 type sequence D description BINDING SITE FOR RESIDUE MN E 3132 source : AC2 2) chain E residue 121 type sequence P description BINDING SITE FOR RESIDUE CL E 3148 source : BC9 3) chain E residue 122 type sequence K description BINDING SITE FOR RESIDUE CL E 3148 source : BC9 4) chain E residue 7 type MOD_RES sequence A description N6-glutaryllysine; alternate => ECO:0000250|UniProtKB:P62805 source Swiss-Prot : SWS_FT_FI10 5) chain E residue 12 type MOD_RES sequence G description N6-glutaryllysine; alternate => ECO:0000250|UniProtKB:P62805 source Swiss-Prot : SWS_FT_FI10 6) chain E residue 38 type MOD_RES sequence P description N6-methyllysine => ECO:0000250|UniProtKB:P68431 source Swiss-Prot : SWS_FT_FI14 7) chain E residue 42 type MOD_RES sequence R description Phosphotyrosine => ECO:0000250|UniProtKB:Q71DI3 source Swiss-Prot : SWS_FT_FI15 8) chain E residue 58 type MOD_RES sequence T description Phosphoserine => ECO:0000250|UniProtKB:Q71DI3 source Swiss-Prot : SWS_FT_FI16 9) chain E residue 81 type MOD_RES sequence D description Phosphothreonine => ECO:0000250|UniProtKB:Q71DI3 source Swiss-Prot : SWS_FT_FI17 10) chain E residue 108 type MOD_RES sequence N description Phosphothreonine => ECO:0000250|UniProtKB:Q71DI3 source Swiss-Prot : SWS_FT_FI17 11) chain E residue 87 type MOD_RES sequence S description Phosphoserine => ECO:0000250|UniProtKB:P84243 source Swiss-Prot : SWS_FT_FI18 12) chain E residue 116 type MOD_RES sequence R description N6-glutaryllysine; alternate => ECO:0000250|UniProtKB:Q71DI3 source Swiss-Prot : SWS_FT_FI19 13) chain E residue 123 type MOD_RES sequence D description N6-succinyllysine; alternate => ECO:0000250|UniProtKB:Q71DI3 source Swiss-Prot : SWS_FT_FI20 14) chain E residue 111 type LIPID sequence A description S-palmitoyl cysteine => ECO:0000250|UniProtKB:Q71DI3 source Swiss-Prot : SWS_FT_FI21 15) chain E residue 65 type MOD_RES sequence L description N6-(2-hydroxyisobutyryl)lysine => ECO:0000250|UniProtKB:P0C0S8 source Swiss-Prot : SWS_FT_FI5 16) chain E residue 19 type MOD_RES sequence Q description N6-(2-hydroxyisobutyryl)lysine => ECO:0000250|UniProtKB:P0C0S8 source Swiss-Prot : SWS_FT_FI5

Display surface Download Links