eF-site ID 1kvs-A PDB Code 1kvs Chain A click to enlarge Title UDP-GALACTOSE 4-EPIMERASE COMPLEXED WITH UDP-PHENOL Classification ISOMERASE Compound UDP-GALACTOSE 4-EPIMERASE Source Escherichia coli (strain K12) (GALE_ECOLI) Sequence A:  MRVLVTGGSGYIGSHTCVQLLQNGHDVIILDNLCNSKRSV LPVIERLGGKHPTFVEGDIRNEALMTEILHDHAIDTVIHF AGLKAVGESVQKPLEYYDNNVNGTLRLISAMRAANVKNFI FSSTATVYGDNPKIPYVESFPTGTPQSPYGKSKLMVEQIL TDLQKAQPDWSIALLRYFNPVGAHPSGDMGEDPQGIPNNL MPYIAQVAVGRRDSLAIFGNDYPTEDGTGVRDYIHVMDLA DGHVVAMEKLANKPGVHIYNLGAGVGNSVLDVVNAFSKAC GKPVNYHFAPRREGDLPAYWADASKADRELNWRVTRTLDE MAQDTWHWQSRHPQGYPD Description Functional site 1) chain A residue 91 type sequence Q description BINDING SITE FOR RESIDUE NA A 412 source : AC1 2) chain A residue 166 type sequence A description BINDING SITE FOR RESIDUE NA A 412 source : AC1 3) chain A residue 194 type sequence Q description BINDING SITE FOR RESIDUE NA A 413 source : AC2 4) chain A residue 196 type sequence I description BINDING SITE FOR RESIDUE NA A 413 source : AC2 5) chain A residue 7 type sequence G description BINDING SITE FOR RESIDUE NAD A 340 source : AC3 6) chain A residue 10 type sequence G description BINDING SITE FOR RESIDUE NAD A 340 source : AC3 7) chain A residue 11 type sequence Y description BINDING SITE FOR RESIDUE NAD A 340 source : AC3 8) chain A residue 12 type sequence I description BINDING SITE FOR RESIDUE NAD A 340 source : AC3 9) chain A residue 31 type sequence D description BINDING SITE FOR RESIDUE NAD A 340 source : AC3 10) chain A residue 32 type sequence N description BINDING SITE FOR RESIDUE NAD A 340 source : AC3 11) chain A residue 33 type sequence L description BINDING SITE FOR RESIDUE NAD A 340 source : AC3 12) chain A residue 34 type sequence C description BINDING SITE FOR RESIDUE NAD A 340 source : AC3 13) chain A residue 35 type sequence N description BINDING SITE FOR RESIDUE NAD A 340 source : AC3 14) chain A residue 36 type sequence S description BINDING SITE FOR RESIDUE NAD A 340 source : AC3 15) chain A residue 57 type sequence G description BINDING SITE FOR RESIDUE NAD A 340 source : AC3 16) chain A residue 58 type sequence D description BINDING SITE FOR RESIDUE NAD A 340 source : AC3 17) chain A residue 59 type sequence I description BINDING SITE FOR RESIDUE NAD A 340 source : AC3 18) chain A residue 80 type sequence F description BINDING SITE FOR RESIDUE NAD A 340 source : AC3 19) chain A residue 82 type sequence G description BINDING SITE FOR RESIDUE NAD A 340 source : AC3 20) chain A residue 84 type sequence K description BINDING SITE FOR RESIDUE NAD A 340 source : AC3 21) chain A residue 99 type sequence N description BINDING SITE FOR RESIDUE NAD A 340 source : AC3 22) chain A residue 122 type sequence S description BINDING SITE FOR RESIDUE NAD A 340 source : AC3 23) chain A residue 123 type sequence S description BINDING SITE FOR RESIDUE NAD A 340 source : AC3 24) chain A residue 149 type sequence Y description BINDING SITE FOR RESIDUE NAD A 340 source : AC3 25) chain A residue 153 type sequence K description BINDING SITE FOR RESIDUE NAD A 340 source : AC3 26) chain A residue 177 type sequence Y description BINDING SITE FOR RESIDUE NAD A 340 source : AC3 27) chain A residue 124 type sequence T description BINDING SITE FOR RESIDUE UPG A 341 source : AC4 28) chain A residue 149 type sequence Y description BINDING SITE FOR RESIDUE UPG A 341 source : AC4 29) chain A residue 178 type sequence F description BINDING SITE FOR RESIDUE UPG A 341 source : AC4 30) chain A residue 179 type sequence N description BINDING SITE FOR RESIDUE UPG A 341 source : AC4 31) chain A residue 198 type sequence N description BINDING SITE FOR RESIDUE UPG A 341 source : AC4 32) chain A residue 199 type sequence N description BINDING SITE FOR RESIDUE UPG A 341 source : AC4 33) chain A residue 200 type sequence L description BINDING SITE FOR RESIDUE UPG A 341 source : AC4 34) chain A residue 215 type sequence L description BINDING SITE FOR RESIDUE UPG A 341 source : AC4 35) chain A residue 216 type sequence A description BINDING SITE FOR RESIDUE UPG A 341 source : AC4 36) chain A residue 217 type sequence I description BINDING SITE FOR RESIDUE UPG A 341 source : AC4 37) chain A residue 218 type sequence F description BINDING SITE FOR RESIDUE UPG A 341 source : AC4 38) chain A residue 231 type sequence R description BINDING SITE FOR RESIDUE UPG A 341 source : AC4 39) chain A residue 233 type sequence Y description BINDING SITE FOR RESIDUE UPG A 341 source : AC4 40) chain A residue 292 type sequence R description BINDING SITE FOR RESIDUE UPG A 341 source : AC4 41) chain A residue 295 type sequence D description BINDING SITE FOR RESIDUE UPG A 341 source : AC4 42) chain A residue 299 type sequence Y description BINDING SITE FOR RESIDUE UPG A 341 source : AC4 43) chain A residue 250 type sequence L description BINDING SITE FOR RESIDUE PEG A 410 source : AC5 44) chain A residue 253 type sequence K description BINDING SITE FOR RESIDUE PEG A 410 source : AC5 45) chain A residue 124 type catalytic sequence T description 188 source MCSA : MCSA1 46) chain A residue 149 type catalytic sequence Y description 188 source MCSA : MCSA1 47) chain A residue 153 type catalytic sequence K description 188 source MCSA : MCSA1 48) chain A residue 149 type ACT_SITE sequence Y description Proton acceptor => ECO:0000269|PubMed:8611497 source Swiss-Prot : SWS_FT_FI1 49) chain A residue 124 type BINDING sequence T description source Swiss-Prot : SWS_FT_FI3 50) chain A residue 149 type BINDING sequence Y description source Swiss-Prot : SWS_FT_FI3 51) chain A residue 179 type BINDING sequence N description source Swiss-Prot : SWS_FT_FI3 52) chain A residue 199 type BINDING sequence N description source Swiss-Prot : SWS_FT_FI3 53) chain A residue 216 type BINDING sequence A description source Swiss-Prot : SWS_FT_FI3 54) chain A residue 231 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI3 55) chain A residue 292 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI3 56) chain A residue 299 type BINDING sequence Y description source Swiss-Prot : SWS_FT_FI3 57) chain A residue 11 type BINDING sequence Y description BINDING => ECO:0000269|PubMed:12019271, ECO:0000269|PubMed:1579570, ECO:0000269|PubMed:8611497, ECO:0000269|PubMed:8611559, ECO:0000269|PubMed:8931134, ECO:0000269|PubMed:9174344, ECO:0000269|PubMed:9271498, ECO:0000269|PubMed:9271499, ECO:0000269|PubMed:9708982 source Swiss-Prot : SWS_FT_FI2 58) chain A residue 31 type BINDING sequence D description BINDING => ECO:0000269|PubMed:12019271, ECO:0000269|PubMed:1579570, ECO:0000269|PubMed:8611497, ECO:0000269|PubMed:8611559, ECO:0000269|PubMed:8931134, ECO:0000269|PubMed:9174344, ECO:0000269|PubMed:9271498, ECO:0000269|PubMed:9271499, ECO:0000269|PubMed:9708982 source Swiss-Prot : SWS_FT_FI2 59) chain A residue 58 type BINDING sequence D description BINDING => ECO:0000269|PubMed:12019271, ECO:0000269|PubMed:1579570, ECO:0000269|PubMed:8611497, ECO:0000269|PubMed:8611559, ECO:0000269|PubMed:8931134, ECO:0000269|PubMed:9174344, ECO:0000269|PubMed:9271498, ECO:0000269|PubMed:9271499, ECO:0000269|PubMed:9708982 source Swiss-Prot : SWS_FT_FI2 60) chain A residue 80 type BINDING sequence F description BINDING => ECO:0000269|PubMed:12019271, ECO:0000269|PubMed:1579570, ECO:0000269|PubMed:8611497, ECO:0000269|PubMed:8611559, ECO:0000269|PubMed:8931134, ECO:0000269|PubMed:9174344, ECO:0000269|PubMed:9271498, ECO:0000269|PubMed:9271499, ECO:0000269|PubMed:9708982 source Swiss-Prot : SWS_FT_FI2 61) chain A residue 99 type BINDING sequence N description BINDING => ECO:0000269|PubMed:12019271, ECO:0000269|PubMed:1579570, ECO:0000269|PubMed:8611497, ECO:0000269|PubMed:8611559, ECO:0000269|PubMed:8931134, ECO:0000269|PubMed:9174344, ECO:0000269|PubMed:9271498, ECO:0000269|PubMed:9271499, ECO:0000269|PubMed:9708982 source Swiss-Prot : SWS_FT_FI2 62) chain A residue 153 type BINDING sequence K description BINDING => ECO:0000269|PubMed:12019271, ECO:0000269|PubMed:1579570, ECO:0000269|PubMed:8611497, ECO:0000269|PubMed:8611559, ECO:0000269|PubMed:8931134, ECO:0000269|PubMed:9174344, ECO:0000269|PubMed:9271498, ECO:0000269|PubMed:9271499, ECO:0000269|PubMed:9708982 source Swiss-Prot : SWS_FT_FI2 63) chain A residue 178 type BINDING sequence F description BINDING => ECO:0000269|PubMed:12019271, ECO:0000269|PubMed:1579570, ECO:0000269|PubMed:8611497, ECO:0000269|PubMed:8611559, ECO:0000269|PubMed:8931134, ECO:0000269|PubMed:9174344, ECO:0000269|PubMed:9271498, ECO:0000269|PubMed:9271499, ECO:0000269|PubMed:9708982 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links