eF-site ID 1krx_9-A
PDB Code 1krx
Model 9
Chain A

click to enlarge
Title SOLUTION STRUCTURE OF BERYLLOFLUORIDE-ACTIVATED NTRC RECEIVER DOMAIN: MODEL STRUCTURES INCORPORATING ACTIVE SITE CONTACTS
Classification SIGNALING PROTEIN
Compound NITROGEN REGULATION PROTEIN NR(I)
Source Salmonella typhimurium (NTRC_SALTY)
Sequence A:  MQRGIVWVVDDDSSIRWVLERALAGAGLTCTTFENGNEVL
AALASKTPDVLLSDIRMPGMDGLALLKQIKQRHPMLPVII
MTAHSDLDAAVSAYQQGAFDYLPKPFDIDEAVALVERAIS
HYQE
Description (1)  NITROGEN REGULATION PROTEIN NR(I)


Functional site

1) chain A
residue 10
type
ligand
sequence D
description BINDING SITE FOR RESIDUE BEF A 125
source : AC1

2) chain A
residue 54
type
ligand
sequence D
description BINDING SITE FOR RESIDUE BEF A 125
source : AC1

3) chain A
residue 55
type
ligand
sequence I
description BINDING SITE FOR RESIDUE BEF A 125
source : AC1

4) chain A
residue 56
type
ligand
sequence R
description BINDING SITE FOR RESIDUE BEF A 125
source : AC1

5) chain A
residue 81
type
ligand
sequence M
description BINDING SITE FOR RESIDUE BEF A 125
source : AC1

6) chain A
residue 82
type
ligand
sequence T
description BINDING SITE FOR RESIDUE BEF A 125
source : AC1

7) chain A
residue 104
type
ligand
sequence K
description BINDING SITE FOR RESIDUE BEF A 125
source : AC1

8) chain A
residue 10-11
type binding
ligand BEF: BERYLLIUM TRIFLUORIDE ION
sequence DD
description BERYLLIUM TRIFLUORIDE ION binding site
source pdb_hetatom : BEF_1krx_A_125

9) chain A
residue 35
type binding
ligand BEF: BERYLLIUM TRIFLUORIDE ION
sequence N
description BERYLLIUM TRIFLUORIDE ION binding site
source pdb_hetatom : BEF_1krx_A_125

10) chain A
residue 54-57
type binding
ligand BEF: BERYLLIUM TRIFLUORIDE ION
sequence DIRM
description BERYLLIUM TRIFLUORIDE ION binding site
source pdb_hetatom : BEF_1krx_A_125

11) chain A
residue 80-82
type binding
ligand BEF: BERYLLIUM TRIFLUORIDE ION
sequence IMT
description BERYLLIUM TRIFLUORIDE ION binding site
source pdb_hetatom : BEF_1krx_A_125

12) chain A
residue 84
type binding
ligand BEF: BERYLLIUM TRIFLUORIDE ION
sequence H
description BERYLLIUM TRIFLUORIDE ION binding site
source pdb_hetatom : BEF_1krx_A_125

13) chain A
residue 104
type binding
ligand BEF: BERYLLIUM TRIFLUORIDE ION
sequence K
description BERYLLIUM TRIFLUORIDE ION binding site
source pdb_hetatom : BEF_1krx_A_125

14) chain A
residue 106
type binding
ligand BEF: BERYLLIUM TRIFLUORIDE ION
sequence F
description BERYLLIUM TRIFLUORIDE ION binding site
source pdb_hetatom : BEF_1krx_A_125

15) chain A
residue 53
type binding
ligand BEF: BERYLLIUM TRIFLUORIDE ION
sequence S
description BERYLLIUM TRIFLUORIDE ION binding site
source pdb_hetatom : BEF_1krx_A_125


Display surface

Download
Links