eF-site ID 1krx_9-A
PDB Code 1krx
Model 9
Chain A

click to enlarge
Title SOLUTION STRUCTURE OF BERYLLOFLUORIDE-ACTIVATED NTRC RECEIVER DOMAIN: MODEL STRUCTURES INCORPORATING ACTIVE SITE CONTACTS
Classification SIGNALING PROTEIN
Compound NITROGEN REGULATION PROTEIN NR(I)
Source Salmonella typhimurium (NTRC_SALTY)
Sequence A:  MQRGIVWVVDDDSSIRWVLERALAGAGLTCTTFENGNEVL
AALASKTPDVLLSDIRMPGMDGLALLKQIKQRHPMLPVII
MTAHSDLDAAVSAYQQGAFDYLPKPFDIDEAVALVERAIS
HYQE
Description (1)  NITROGEN REGULATION PROTEIN NR(I)


Functional site

1) chain A
residue 10
type
ligand
sequence D
description BINDING SITE FOR RESIDUE BEF A 125
source : AC1

2) chain A
residue 54
type
ligand
sequence D
description BINDING SITE FOR RESIDUE BEF A 125
source : AC1

3) chain A
residue 55
type
ligand
sequence I
description BINDING SITE FOR RESIDUE BEF A 125
source : AC1

4) chain A
residue 56
type
ligand
sequence R
description BINDING SITE FOR RESIDUE BEF A 125
source : AC1

5) chain A
residue 81
type
ligand
sequence M
description BINDING SITE FOR RESIDUE BEF A 125
source : AC1

6) chain A
residue 82
type
ligand
sequence T
description BINDING SITE FOR RESIDUE BEF A 125
source : AC1

7) chain A
residue 104
type
ligand
sequence K
description BINDING SITE FOR RESIDUE BEF A 125
source : AC1


Display surface

Download
Links