eF-site ID 1kmy-A PDB Code 1kmy Chain A click to enlarge Title Crystal Structure of 2,3-dihydroxybiphenyl 1,2-dioxygenase Complexed with 2,3-dihydroxybiphenyl under Anaerobic Condition Classification OXIDOREDUCTASE Compound 2,3-DIHYDROXYBIPHENYL 1,2-DIOXYGENASE Source null (BPHC_BURCE) Sequence A:  SIRSLGYMGFAVSDVAAWRSFLTQKLGLMEAGTTDNGDLF RIDSRAWRIAVQQGEVDDLAFAGYEVADAAGLAQMADKLK QAGIAVTTGDASLARRRGVTGLITFADPFGLPLEIYYGAS EVFEKPFLPGAAVSGFLTGEQGLGHFVRCVPDSDKALAFY TDVLGFQLSDVIDMKMGPDVTVPAYFLHCNERHHTLAIAA FPLPKRIHHFMLEVASLDDVGFAFDRVDADGLITSTLGRH TNDHMVSFYASTPSGVEVEYGWSARTVDRSWVVVRHDSPS MWGHKSVR Description Functional site 1) chain A residue 146 type sequence H description BINDING SITE FOR RESIDUE FE2 A 500 source : AC1 2) chain A residue 210 type sequence H description BINDING SITE FOR RESIDUE FE2 A 500 source : AC1 3) chain A residue 260 type sequence E description BINDING SITE FOR RESIDUE FE2 A 500 source : AC1 4) chain A residue 146 type sequence H description BINDING SITE FOR RESIDUE BPY A 300 source : AC2 5) chain A residue 175 type sequence M description BINDING SITE FOR RESIDUE BPY A 300 source : AC2 6) chain A residue 187 type sequence F description BINDING SITE FOR RESIDUE BPY A 300 source : AC2 7) chain A residue 195 type sequence H description BINDING SITE FOR RESIDUE BPY A 300 source : AC2 8) chain A residue 210 type sequence H description BINDING SITE FOR RESIDUE BPY A 300 source : AC2 9) chain A residue 241 type sequence H description BINDING SITE FOR RESIDUE BPY A 300 source : AC2 10) chain A residue 243 type sequence N description BINDING SITE FOR RESIDUE BPY A 300 source : AC2 11) chain A residue 244 type sequence D description BINDING SITE FOR RESIDUE BPY A 300 source : AC2 12) chain A residue 250 type sequence Y description BINDING SITE FOR RESIDUE BPY A 300 source : AC2 13) chain A residue 260 type sequence E description BINDING SITE FOR RESIDUE BPY A 300 source : AC2 14) chain A residue 236 type sequence S description BINDING SITE FOR RESIDUE TBU A 601 source : AC3 15) chain A residue 285 type sequence H description BINDING SITE FOR RESIDUE TBU A 601 source : AC3 16) chain A residue 289 type sequence R description BINDING SITE FOR RESIDUE TBU A 601 source : AC3 17) chain A residue 239-260 type prosite sequence GRHTNDHMVSFYASTPSGVEVE description EXTRADIOL_DIOXYGENAS Extradiol ring-cleavage dioxygenases signature. GrHtndhmvsFYasTPsGvevE source prosite : PS00082 18) chain A residue 147 type BINDING sequence F description source Swiss-Prot : SWS_FT_FI1 19) chain A residue 211 type BINDING sequence F description source Swiss-Prot : SWS_FT_FI1 20) chain A residue 261 type BINDING sequence Y description source Swiss-Prot : SWS_FT_FI1

Display surface Download Links