eF-site ID 1ki1-A PDB Code 1ki1 Chain A click to enlarge Title Guanine Nucleotide Exchange Region of Intersectin in Complex with Cdc42 Classification SIGNALING PROTEIN Compound G25K GTP-binding protein, placental isoform Source null (ITSN1_HUMAN) Sequence A:  MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNY AVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLV CFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLR DDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSAL TQKGLKNVFDEAILAALE Description Functional site 1) chain A residue 11 type sequence D description BINDING SITE FOR RESIDUE SO4 A 4001 source : AC1 2) chain A residue 12 type sequence G description BINDING SITE FOR RESIDUE SO4 A 4001 source : AC1 3) chain A residue 13 type sequence A description BINDING SITE FOR RESIDUE SO4 A 4001 source : AC1 4) chain A residue 14 type sequence V description BINDING SITE FOR RESIDUE SO4 A 4001 source : AC1 5) chain A residue 15 type sequence G description BINDING SITE FOR RESIDUE SO4 A 4001 source : AC1 6) chain A residue 16 type sequence K description BINDING SITE FOR RESIDUE SO4 A 4001 source : AC1 7) chain A residue 17 type sequence T description BINDING SITE FOR RESIDUE SO4 A 4001 source : AC1 8) chain A residue 35 type CARBOHYD sequence T description (Microbial infection) O-linked (Glc) threonine; by C.difficile toxins TcdA and TcdB; alternate => ECO:0000269|PubMed:24905543, ECO:0000269|PubMed:7775453, ECO:0000269|PubMed:7777059 source Swiss-Prot : SWS_FT_FI9 9) chain A residue 57 type BINDING sequence D description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI2 10) chain A residue 32 type MOD_RES sequence Y description (Microbial infection) O-AMP-tyrosine; by Haemophilus IbpA; alternate => ECO:0000269|PubMed:19362538, ECO:0000269|PubMed:20622875 source Swiss-Prot : SWS_FT_FI3 11) chain A residue 35 type MOD_RES sequence T description (Microbial infection) O-AMP-threonine; by Vibrio VopS => ECO:0000269|PubMed:19039103 source Swiss-Prot : SWS_FT_FI4 12) chain A residue 64 type MOD_RES sequence Y description Phosphotyrosine; by SRC => ECO:0000269|PubMed:14506284 source Swiss-Prot : SWS_FT_FI5 13) chain A residue 32 type CARBOHYD sequence Y description (Microbial infection) O-linked (GlcNAc) tyrosine; by Photorhabdus PAU_02230; alternate => ECO:0000269|PubMed:24141704 source Swiss-Prot : SWS_FT_FI8 14) chain A residue 10 type BINDING sequence G description source Swiss-Prot : SWS_FT_FI1 15) chain A residue 115 type BINDING sequence T description source Swiss-Prot : SWS_FT_FI1

Display surface Download Links