eF-site ID 1keb-AB PDB Code 1keb Chain A, B click to enlarge Title Crystal Structure of Double Mutant M37L,P40S E.coli Thioredoxin Classification ELECTRON TRANSPORT Compound Thioredoxin 1 Source Escherichia coli (strain K12) (THIO_ECOLI) Sequence A:  SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKLIAS ILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLL FKNGEVAATKVGALSKGQLKEFLDANLA B:  SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKLIAS ILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLL FKNGEVAATKVGALSKGQLKEFLDANLA Description Functional site 1) chain A residue 1 type sequence S description BINDING SITE FOR RESIDUE CU A 109 source : AC1 2) chain A residue 2 type sequence D description BINDING SITE FOR RESIDUE CU A 109 source : AC1 3) chain B residue 6 type sequence H description BINDING SITE FOR RESIDUE CU A 109 source : AC1 4) chain A residue 10 type sequence D description BINDING SITE FOR RESIDUE CU B 109 source : AC2 5) chain B residue 1 type sequence S description BINDING SITE FOR RESIDUE CU B 109 source : AC2 6) chain B residue 2 type sequence D description BINDING SITE FOR RESIDUE CU B 109 source : AC2 7) chain A residue 70 type MOD_RES sequence Y description N6-acetyllysine => ECO:0000269|PubMed:18723842 source Swiss-Prot : SWS_FT_FI4 8) chain B residue 70 type MOD_RES sequence Y description N6-acetyllysine => ECO:0000269|PubMed:18723842 source Swiss-Prot : SWS_FT_FI4 9) chain A residue 33 type ACT_SITE sequence G description Nucleophile source Swiss-Prot : SWS_FT_FI1 10) chain A residue 36 type ACT_SITE sequence K description Nucleophile source Swiss-Prot : SWS_FT_FI1 11) chain B residue 33 type ACT_SITE sequence G description Nucleophile source Swiss-Prot : SWS_FT_FI1 12) chain B residue 36 type ACT_SITE sequence K description Nucleophile source Swiss-Prot : SWS_FT_FI1 13) chain A residue 27 type SITE sequence F description Deprotonates C-terminal active site Cys source Swiss-Prot : SWS_FT_FI2 14) chain B residue 27 type SITE sequence F description Deprotonates C-terminal active site Cys source Swiss-Prot : SWS_FT_FI2 15) chain A residue 34 type SITE sequence P description Contributes to redox potential value source Swiss-Prot : SWS_FT_FI3 16) chain A residue 35 type SITE sequence C description Contributes to redox potential value source Swiss-Prot : SWS_FT_FI3 17) chain B residue 34 type SITE sequence P description Contributes to redox potential value source Swiss-Prot : SWS_FT_FI3 18) chain B residue 35 type SITE sequence C description Contributes to redox potential value source Swiss-Prot : SWS_FT_FI3 19) chain A residue 24-42 type prosite sequence LVDFWAEWCGPCKLIASIL description THIOREDOXIN_1 Thioredoxin family active site. LVdFWaeWCGPCKlIasiL source prosite : PS00194

Display surface Download Links