eF-site ID 1ke7-A PDB Code 1ke7 Chain A click to enlarge Title CYCLIN-DEPENDENT KINASE 2 (CDK2) COMPLEXED WITH 3-{[(2,2-DIOXIDO-1,3-DIHYDRO-2-BENZOTHIEN-5-YL)AMINO]METHYLENE}-5-(1,3-OXAZOL-5-YL)-1,3-DIHYDRO-2H-INDOL-2-ONE Classification TRANSFERASE Compound Cell division protein kinase 2 Source null (CDK2_HUMAN) Sequence A:  MENFQKVEKIGEGTYGVVYKARNKLTGEVVALKKIRVPST AIREISLLKELNHPNIVKLLDVIHTENKLYLVFEFLHQDL KKFMDASALTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRD LKPQNLLINTEGAIKLADFGLARAFVVTLWYRAPEILLGC KYYSTAVDIWSLGCIFAEMVTRRALFPGDSEIDQLFRIFR TLGTPDEVVWPGVTSMPDYKPSFPKWARQDFSKVVPPLDE DGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLR L Description Functional site 1) chain A residue 10 type sequence I description BINDING SITE FOR RESIDUE LS3 A 299 source : AC1 2) chain A residue 13 type sequence G description BINDING SITE FOR RESIDUE LS3 A 299 source : AC1 3) chain A residue 31 type sequence A description BINDING SITE FOR RESIDUE LS3 A 299 source : AC1 4) chain A residue 33 type sequence K description BINDING SITE FOR RESIDUE LS3 A 299 source : AC1 5) chain A residue 80 type sequence F description BINDING SITE FOR RESIDUE LS3 A 299 source : AC1 6) chain A residue 81 type sequence E description BINDING SITE FOR RESIDUE LS3 A 299 source : AC1 7) chain A residue 82 type sequence F description BINDING SITE FOR RESIDUE LS3 A 299 source : AC1 8) chain A residue 83 type sequence L description BINDING SITE FOR RESIDUE LS3 A 299 source : AC1 9) chain A residue 84 type sequence H description BINDING SITE FOR RESIDUE LS3 A 299 source : AC1 10) chain A residue 85 type sequence Q description BINDING SITE FOR RESIDUE LS3 A 299 source : AC1 11) chain A residue 86 type sequence D description BINDING SITE FOR RESIDUE LS3 A 299 source : AC1 12) chain A residue 89 type sequence K description BINDING SITE FOR RESIDUE LS3 A 299 source : AC1 13) chain A residue 132 type sequence N description BINDING SITE FOR RESIDUE LS3 A 299 source : AC1 14) chain A residue 134 type sequence L description BINDING SITE FOR RESIDUE LS3 A 299 source : AC1 15) chain A residue 145 type sequence D description BINDING SITE FOR RESIDUE LS3 A 299 source : AC1 16) chain A residue 127 type ACT_SITE sequence D description Proton acceptor source Swiss-Prot : SWS_FT_FI1 17) chain A residue 132 type BINDING sequence N description BINDING => ECO:0000269|PubMed:21565702 source Swiss-Prot : SWS_FT_FI3 18) chain A residue 145 type BINDING sequence D description BINDING => ECO:0000269|PubMed:21565702 source Swiss-Prot : SWS_FT_FI3 19) chain A residue 9 type SITE sequence K description CDK7 binding source Swiss-Prot : SWS_FT_FI4 20) chain A residue 88 type SITE sequence K description CDK7 binding source Swiss-Prot : SWS_FT_FI4 21) chain A residue 166 type SITE sequence L description CDK7 binding source Swiss-Prot : SWS_FT_FI4 22) chain A residue 6 type MOD_RES sequence K description N6-acetyllysine => ECO:0007744|PubMed:19608861 source Swiss-Prot : SWS_FT_FI6 23) chain A residue 14 type MOD_RES sequence T description Phosphothreonine => ECO:0000269|PubMed:1396589, ECO:0000269|PubMed:17095507 source Swiss-Prot : SWS_FT_FI7 24) chain A residue 15 type MOD_RES sequence Y description Phosphotyrosine; by WEE1 => ECO:0000269|PubMed:1396589, ECO:0000269|PubMed:17095507, ECO:0007744|PubMed:19690332 source Swiss-Prot : SWS_FT_FI8 25) chain A residue 19 type MOD_RES sequence Y description Phosphotyrosine => ECO:0007744|PubMed:19369195 source Swiss-Prot : SWS_FT_FI9 26) chain A residue 10-33 type prosite sequence IGEGTYGVVYKARNKLTGEVVALK description PROTEIN_KINASE_ATP Protein kinases ATP-binding region signature. IGEGTYGVVYkArnkltgev..........VALK source prosite : PS00107 27) chain A residue 123-135 type prosite sequence VLHRDLKPQNLLI description PROTEIN_KINASE_ST Serine/Threonine protein kinases active-site signature. VlHrDLKpqNLLI source prosite : PS00108 28) chain A residue 33 type BINDING sequence K description BINDING => ECO:0000255|PROSITE-ProRule:PRU00159, ECO:0000269|PubMed:17095507, ECO:0000269|PubMed:21565702 source Swiss-Prot : SWS_FT_FI2 29) chain A residue 81 type BINDING sequence E description BINDING => ECO:0000255|PROSITE-ProRule:PRU00159, ECO:0000269|PubMed:17095507, ECO:0000269|PubMed:21565702 source Swiss-Prot : SWS_FT_FI2 30) chain A residue 86 type BINDING sequence D description BINDING => ECO:0000255|PROSITE-ProRule:PRU00159, ECO:0000269|PubMed:17095507, ECO:0000269|PubMed:21565702 source Swiss-Prot : SWS_FT_FI2 31) chain A residue 129 type BINDING sequence K description BINDING => ECO:0000255|PROSITE-ProRule:PRU00159, ECO:0000269|PubMed:17095507, ECO:0000269|PubMed:21565702 source Swiss-Prot : SWS_FT_FI2 32) chain A residue 10 type BINDING sequence I description BINDING => ECO:0000255|PROSITE-ProRule:PRU00159, ECO:0000269|PubMed:17095507, ECO:0000269|PubMed:21565702 source Swiss-Prot : SWS_FT_FI2 33) chain A residue 1 type MOD_RES sequence M description N-acetylmethionine => ECO:0007744|PubMed:22814378 source Swiss-Prot : SWS_FT_FI5

Display surface Download Links