eF-site ID 1kc8-U PDB Code 1kc8 Chain U click to enlarge Title Co-crystal Structure of Blasticidin S Bound to the 50S Ribosomal Subunit Classification RIBOSOME Compound 23S RRNA Source ORGANISM_SCIENTIFIC: Haloarcula marismortui; Sequence U:  SKQPDKQRKSQRRAPLHERHKQVRATLSADLREEYGQRNV RVNAGDTVEVLRGDFAGEEGEVINVDLDKAVIHVEDVTLE KTDGEEVPRPLDTSNVRVTDLDLEDEKREARLESEDDSA Description Functional site 1) chain U residue 37 type sequence Q description BINDING SITE FOR RESIDUE MG U 8073 source : YC9 2) chain U residue 111 type sequence R description BINDING SITE FOR RESIDUE MG U 8073 source : YC9 3) chain U residue 112 type sequence L description BINDING SITE FOR RESIDUE MG U 8073 source : YC9 4) chain U residue 114 type sequence S description BINDING SITE FOR RESIDUE MG U 8073 source : YC9 5) chain U residue 117 type sequence D description BINDING SITE FOR RESIDUE MG U 8073 source : YC9 6) chain U residue 94 type sequence S description BINDING SITE FOR RESIDUE NA U 8343 source : ZC1 7) chain U residue 95 type sequence N description BINDING SITE FOR RESIDUE NA U 8343 source : ZC1 8) chain U residue 45-62 type prosite sequence GDTVEVLRGDFAGEEGEV description RIBOSOMAL_L24 Ribosomal protein L24 signature. GDtVeVLrGdfAGee.GeV source prosite : PS01108

Display surface Download Links