eF-site ID 1kc8-R PDB Code 1kc8 Chain R click to enlarge Title Co-crystal Structure of Blasticidin S Bound to the 50S Ribosomal Subunit Classification RIBOSOME Compound 23S RRNA Source ORGANISM_SCIENTIFIC: Haloarcula marismortui; Sequence R:  PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVH LKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGK EKTIIVTAAHLRRQE Description Functional site 1) chain R residue 52 type sequence F description BINDING SITE FOR RESIDUE CL A 8511 source : UC9 2) chain R residue 53 type sequence H description BINDING SITE FOR RESIDUE CL A 8511 source : UC9 3) chain R residue 56 type sequence F description BINDING SITE FOR RESIDUE CL A 8511 source : UC9 4) chain R residue 20 type sequence D description BINDING SITE FOR RESIDUE NA R 8348 source : YC3 5) chain R residue 22 type sequence G description BINDING SITE FOR RESIDUE NA R 8348 source : YC3 6) chain R residue 24 type sequence S description BINDING SITE FOR RESIDUE NA R 8348 source : YC3 7) chain R residue 46 type sequence S description BINDING SITE FOR RESIDUE NA R 8348 source : YC3 8) chain R residue 36-61 type prosite sequence GEKVHLKIDPSVPNGRFHPRFDGQTG description RIBOSOMAL_L21E Ribosomal protein L21e signature. GEkVhlkidpsvpn.GrfHprFdGqTG source prosite : PS01171

Display surface Download Links