eF-site ID 1kc8-M PDB Code 1kc8 Chain M click to enlarge Title Co-crystal Structure of Blasticidin S Bound to the 50S Ribosomal Subunit Classification RIBOSOME Compound 23S RRNA Source ORGANISM_SCIENTIFIC: Haloarcula marismortui; Sequence M:  TSKKKRQRGSRTHGGGSHKNRRGAGHRGGRGDAGRDKHEF HNHEPLGKSGFKRPQKVQEEAATIDVREIDENVTLLAADD VAEFRVDVRDVVEEADDADYVKVLGAGQVRHELTLIADDF SEGAREKVEGAGGSVELTDLGEERQ Description Functional site 1) chain M residue 8 type sequence R description BINDING SITE FOR RESIDUE NA A 8303 source : NC1 2) chain M residue 36 type sequence D description BINDING SITE FOR RESIDUE NA A 8319 source : OC5 3) chain M residue 14 type sequence G description BINDING SITE FOR RESIDUE NA A 8353 source : RC3 4) chain M residue 18 type sequence H description BINDING SITE FOR RESIDUE NA A 8378 source : UC1 5) chain M residue 13 type sequence H description BINDING SITE FOR RESIDUE CL A 8514 source : VC3 6) chain M residue 27 type sequence R description BINDING SITE FOR RESIDUE NA M 8380 source : XC5 7) chain M residue 28 type sequence G description BINDING SITE FOR RESIDUE NA M 8380 source : XC5 8) chain M residue 29 type sequence G description BINDING SITE FOR RESIDUE NA M 8380 source : XC5 9) chain M residue 31 type sequence G description BINDING SITE FOR RESIDUE NA M 8380 source : XC5 10) chain M residue 33 type sequence A description BINDING SITE FOR RESIDUE NA M 8380 source : XC5 11) chain M residue 39 type sequence E description BINDING SITE FOR RESIDUE NA M 8380 source : XC5 12) chain M residue 52 type sequence K description BINDING SITE FOR RESIDUE CL M 8510 source : XC6 13) chain M residue 53 type sequence R description BINDING SITE FOR RESIDUE CL M 8510 source : XC6 14) chain M residue 107-137 type prosite sequence KVLGAGQVRHELTLIADDFSEGAREKVEGAG description RIBOSOMAL_L15 Ribosomal protein L15 signature. KVLGaGqVrhe..LtLiaddFSegArekVegaG source prosite : PS00475

Display surface Download Links