eF-site ID 1kc8-1 PDB Code 1kc8 Chain 1 click to enlarge Title Co-crystal Structure of Blasticidin S Bound to the 50S Ribosomal Subunit Classification RIBOSOME Compound 23S RRNA Source ORGANISM_SCIENTIFIC: Haloarcula marismortui; Sequence 1:  RTGRFGPRYGLKIRVRVADVEIKHKKKHKCPVCGFKKLKR AGTGIWMCGHCGYKIAGGCYQPETVAGKAVMKA Description Functional site 1) chain 1 residue 13 type sequence R description BINDING SITE FOR RESIDUE MG 1 8105 source : ZC5 2) chain 1 residue 14 type sequence F description BINDING SITE FOR RESIDUE MG 1 8105 source : ZC5 3) chain 1 residue 42 type sequence C description BINDING SITE FOR RESIDUE CD 1 8403 source : ZC6 4) chain 1 residue 60 type sequence C description BINDING SITE FOR RESIDUE CD 1 8403 source : ZC6 5) chain 1 residue 39 type BINDING sequence C description BINDING => ECO:0000255|HAMAP-Rule:MF_00327 source Swiss-Prot : SWS_FT_FI2 6) chain 1 residue 42 type BINDING sequence C description BINDING => ECO:0000255|HAMAP-Rule:MF_00327 source Swiss-Prot : SWS_FT_FI2 7) chain 1 residue 57 type BINDING sequence C description BINDING => ECO:0000255|HAMAP-Rule:MF_00327 source Swiss-Prot : SWS_FT_FI2 8) chain 1 residue 60 type BINDING sequence C description BINDING => ECO:0000255|HAMAP-Rule:MF_00327 source Swiss-Prot : SWS_FT_FI2 9) chain 1 residue 39-60 type ZN_FING sequence CPVCGFKKLKRAGTGIWMCGHC description C4-type => ECO:0000255|HAMAP-Rule:MF_00327 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links