eF-site ID 1kbe-A PDB Code 1kbe Chain A click to enlarge Title Solution structure of the cysteine-rich C1 domain of Kinase Suppressor of Ras Classification SIGNALING PROTEIN Compound Kinase Suppressor of Ras Source Mus musculus (Mouse) (KSR1_MOUSE) Sequence A:  GSVTHRFSTKSWLSQVCNVCQKSMIFGVKCKHCRLKCHNK CTKEAPACR Description Functional site 1) chain A residue 334 type sequence H description BINDING SITE FOR RESIDUE ZN A 1 source : AC1 2) chain A residue 359 type sequence C description BINDING SITE FOR RESIDUE ZN A 1 source : AC1 3) chain A residue 360 type sequence K description BINDING SITE FOR RESIDUE ZN A 1 source : AC1 4) chain A residue 362 type sequence C description BINDING SITE FOR RESIDUE ZN A 1 source : AC1 5) chain A residue 377 type sequence C description BINDING SITE FOR RESIDUE ZN A 1 source : AC1 6) chain A residue 346 type sequence C description BINDING SITE FOR RESIDUE ZN A 2 source : AC2 7) chain A residue 349 type sequence C description BINDING SITE FOR RESIDUE ZN A 2 source : AC2 8) chain A residue 367 type sequence H description BINDING SITE FOR RESIDUE ZN A 2 source : AC2 9) chain A residue 370 type sequence C description BINDING SITE FOR RESIDUE ZN A 2 source : AC2 10) chain A residue 333-377 type ZN_FING sequence THRFSTKSWLSQVCNVCQKSMIFGVKCKHCRLKCHNKCTK EAPAC description Phorbol-ester/DAG-type => ECO:0000255|PROSITE-ProRule:PRU00226 source Swiss-Prot : SWS_FT_FI1 11) chain A residue 334 type BINDING sequence H description BINDING => ECO:0000269|PubMed:11786023 source Swiss-Prot : SWS_FT_FI2 12) chain A residue 346 type BINDING sequence C description BINDING => ECO:0000269|PubMed:11786023 source Swiss-Prot : SWS_FT_FI2 13) chain A residue 349 type BINDING sequence C description BINDING => ECO:0000269|PubMed:11786023 source Swiss-Prot : SWS_FT_FI2 14) chain A residue 362 type BINDING sequence C description BINDING => ECO:0000269|PubMed:11786023 source Swiss-Prot : SWS_FT_FI2 15) chain A residue 367 type BINDING sequence H description BINDING => ECO:0000269|PubMed:11786023 source Swiss-Prot : SWS_FT_FI2 16) chain A residue 370 type BINDING sequence C description BINDING => ECO:0000269|PubMed:11786023 source Swiss-Prot : SWS_FT_FI2 17) chain A residue 377 type BINDING sequence C description BINDING => ECO:0000269|PubMed:11786023 source Swiss-Prot : SWS_FT_FI2 18) chain A residue 359 type BINDING sequence C description BINDING => ECO:0000269|PubMed:11786023 source Swiss-Prot : SWS_FT_FI2 19) chain A residue 337 type MOD_RES sequence S description Phosphoserine => ECO:0000250|UniProtKB:Q8IVT5 source Swiss-Prot : SWS_FT_FI3 20) chain A residue 334-377 type prosite sequence HRFSTKSWLSQVCNVCQKSMIFGVKCKHCRLKCHNKCTKE APAC description ZF_DAG_PE_1 Zinc finger phorbol-ester/DAG-type signature. HrFstkswlsqv..CnvCqksMifgvk.....CkhCrlkcHnkCtkeapa...C source prosite : PS00479

Display surface Download Links