eF-site ID 1k83-J PDB Code 1k83 Chain J click to enlarge Title Crystal Structure of Yeast RNA Polymerase II Complexed with the Inhibitor Alpha Amanitin Classification TRANSCRIPTION/TOXIN Compound DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT Source ORGANISM_COMMON: BAKER'S YEAST; ORGANISM_SCIENTIFIC: SACCHAROMYCES CEREVISIAE; Sequence J:  MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLG LKRYCCRRMILTHVDLIEKFLRYNP Description Functional site 1) chain J residue 7 type sequence C description BINDING SITE FOR RESIDUE ZN J3001 source : AC1 2) chain J residue 10 type sequence C description BINDING SITE FOR RESIDUE ZN J3001 source : AC1 3) chain J residue 45 type sequence C description BINDING SITE FOR RESIDUE ZN J3001 source : AC1 4) chain J residue 46 type sequence C description BINDING SITE FOR RESIDUE ZN J3001 source : AC1 5) chain J residue 10 type MOD_RES sequence C description (3R,4S)-4-hydroxyisoleucine; in form gamma-amanitin => ECO:0000269|PubMed:11805306 source Swiss-Prot : SWS_FT_FI1 6) chain J residue 45 type MOD_RES sequence C description (3R,4S)-4-hydroxyisoleucine; in form gamma-amanitin => ECO:0000269|PubMed:11805306 source Swiss-Prot : SWS_FT_FI1 7) chain J residue 46 type MOD_RES sequence C description (3R,4S)-4-hydroxyisoleucine; in form gamma-amanitin => ECO:0000269|PubMed:11805306 source Swiss-Prot : SWS_FT_FI1 8) chain J residue 2-11 type prosite sequence IVPVRCFSCG description RNA_POL_N_8KD RNA polymerases N / 8 Kd subunits signature. IVPVrCFSCG source prosite : PS01112

Display surface Download Links