eF-site ID 1k83-I PDB Code 1k83 Chain I click to enlarge Title Crystal Structure of Yeast RNA Polymerase II Complexed with the Inhibitor Alpha Amanitin Classification TRANSCRIPTION/TOXIN Compound DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT Source ORGANISM_COMMON: BAKER'S YEAST; ORGANISM_SCIENTIFIC: SACCHAROMYCES CEREVISIAE; Sequence I:  MTTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGS PLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHS RENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ FS Description Functional site 1) chain I residue 7 type sequence C description BINDING SITE FOR RESIDUE ZN I3003 source : AC3 2) chain I residue 10 type sequence C description BINDING SITE FOR RESIDUE ZN I3003 source : AC3 3) chain I residue 29 type sequence C description BINDING SITE FOR RESIDUE ZN I3003 source : AC3 4) chain I residue 32 type sequence C description BINDING SITE FOR RESIDUE ZN I3003 source : AC3 5) chain I residue 75 type sequence C description BINDING SITE FOR RESIDUE ZN I3004 source : AC4 6) chain I residue 78 type sequence C description BINDING SITE FOR RESIDUE ZN I3004 source : AC4 7) chain I residue 103 type sequence C description BINDING SITE FOR RESIDUE ZN I3004 source : AC4 8) chain I residue 106 type sequence C description BINDING SITE FOR RESIDUE ZN I3004 source : AC4 9) chain I residue 29 type CROSSLNK sequence C description Cyclopeptide (Ile-Pro) => ECO:0000269|PubMed:18552824, ECO:0000269|PubMed:363352, ECO:0000269|PubMed:4865716 source Swiss-Prot : SWS_FT_FI3 10) chain I residue 32 type CROSSLNK sequence C description Cyclopeptide (Ile-Pro) => ECO:0000269|PubMed:18552824, ECO:0000269|PubMed:363352, ECO:0000269|PubMed:4865716 source Swiss-Prot : SWS_FT_FI3 11) chain I residue 103 type CROSSLNK sequence C description 2'-cysteinyl-6'-hydroxytryptophan sulfoxide (Trp-Cys) => ECO:0000305 source Swiss-Prot : SWS_FT_FI4 12) chain I residue 106 type CROSSLNK sequence C description 2'-cysteinyl-6'-hydroxytryptophan sulfoxide (Trp-Cys) => ECO:0000305 source Swiss-Prot : SWS_FT_FI4 13) chain I residue 40 type MOD_RES sequence S description Phosphoserine => ECO:0007744|PubMed:18407956 source Swiss-Prot : SWS_FT_FI5 14) chain I residue 75-110 type prosite sequence CPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIF description ZF_TFIIS_1 Zinc finger TFIIS-type signature. CpkChsrenvffqSQQRRkDTSmvlffvCls...CshiF source prosite : PS00466 15) chain I residue 6-32 type prosite sequence FCRDCNNMLYPREDKENNRLLFECRTC description RNA_POL_M_15KD RNA polymerases M / 15 Kd subunits signature. FCrDCNNMLypredkennrllfeCrtC source prosite : PS01030

Display surface Download Links