eF-site ID 1k74-A PDB Code 1k74 Chain A click to enlarge Title The 2.3 Angstrom resolution crystal structure of the heterodimer of the human PPARgamma and RXRalpha ligand binding domains respectively bound with GW409544 and 9-cis retinoic acid and co-activator peptides. Classification TRANSCRIPTION Compound Retinoic acid receptor RXR-alpha Source Homo sapiens (Human) (O43792_TOBAC) Sequence A:  NEDMPVERILEAELAVEPKTETYVEANMGLNPSSPNDPVT NICQAADKQLFTLVEWAKRIPHFSELPLDDQVILLRAGWN ELLIASFSHRSIAVKDGILLATGLHVHRNSAHSAGVGAIF DRVLTELVSKMRDMQMDKTELGCLRAIVLFNPDSKGLSNP AEVEALREKVYASLEAYCKHKYPEQPGRFAKLLLRLPALR SIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAP Description Functional site 1) chain A residue 268 type sequence I description BINDING SITE FOR RESIDUE 9CR A 463 source : AC1 2) chain A residue 271 type sequence A description BINDING SITE FOR RESIDUE 9CR A 463 source : AC1 3) chain A residue 272 type sequence A description BINDING SITE FOR RESIDUE 9CR A 463 source : AC1 4) chain A residue 275 type sequence Q description BINDING SITE FOR RESIDUE 9CR A 463 source : AC1 5) chain A residue 305 type sequence W description BINDING SITE FOR RESIDUE 9CR A 463 source : AC1 6) chain A residue 313 type sequence F description BINDING SITE FOR RESIDUE 9CR A 463 source : AC1 7) chain A residue 316 type sequence R description BINDING SITE FOR RESIDUE 9CR A 463 source : AC1 8) chain A residue 326 type sequence L description BINDING SITE FOR RESIDUE 9CR A 463 source : AC1 9) chain A residue 327 type sequence A description BINDING SITE FOR RESIDUE 9CR A 463 source : AC1 10) chain A residue 432 type sequence C description BINDING SITE FOR RESIDUE 9CR A 463 source : AC1 11) chain A residue 435 type sequence H description BINDING SITE FOR RESIDUE 9CR A 463 source : AC1 12) chain A residue 436 type sequence L description BINDING SITE FOR RESIDUE 9CR A 463 source : AC1 13) chain A residue 260 type MOD_RES sequence S description Phosphoserine; by MAPK8 and MAPK9 => ECO:0000250|UniProtKB:P28700 source Swiss-Prot : SWS_FT_FI3

Display surface Download Links