eF-site ID 1k73-W PDB Code 1k73 Chain W click to enlarge Title Co-crystal Structure of Anisomycin Bound to the 50S Ribosomal Subunit Classification RIBOSOME Compound 23S RRNA Source ORGANISM_SCIENTIFIC: Haloarcula marismortui; Sequence W:  TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAP ENPGRIKELRKAIARIKTIQGEEGD Description Functional site 1) chain W residue 42-56 type prosite sequence NPGRIKELRKAIARI description RIBOSOMAL_L29 Ribosomal protein L29 signature. NPGRIKeLRKAIARI source prosite : PS00579

Display surface Download Links