eF-site ID 1k73-P PDB Code 1k73 Chain P click to enlarge Title Co-crystal Structure of Anisomycin Bound to the 50S Ribosomal Subunit Classification RIBOSOME Compound 23S RRNA Source ORGANISM_SCIENTIFIC: Haloarcula marismortui; Sequence P:  SKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTH AEVNLGRIERYAQEDETVVVPGKVLGSGVLQKDVTVAAVD FSGTAETKIDQVGEAVSLEQAIENNPEGSHVRVIR Description Functional site 1) chain P residue 40 type sequence H description BINDING SITE FOR RESIDUE CD P 8405 source : XC8 2) chain P residue 44 type sequence N description BINDING SITE FOR RESIDUE CL P 8508 source : XC9 3) chain P residue 47 type sequence R description BINDING SITE FOR RESIDUE CL P 8508 source : XC9 4) chain P residue 31-48 type prosite sequence ERLEKPRRTHAEVNLGRI description RIBOSOMAL_L18E Ribosomal protein L18e signature. ErLekPRrtHAeVNLgRI source prosite : PS01106 5) chain P residue 63-93 type prosite sequence KVLGSGVLQKDVTVAAVDFSGTAETKIDQVG description RIBOSOMAL_L15 Ribosomal protein L15 signature. KVLGaGqVrhe..LtLiaddFSegArekVegaG source prosite : PS00475

Display surface Download Links