eF-site ID 1k73-N PDB Code 1k73 Chain N click to enlarge Title Co-crystal Structure of Anisomycin Bound to the 50S Ribosomal Subunit Classification RIBOSOME Compound 23S RRNA Source ORGANISM_SCIENTIFIC: Haloarcula marismortui; Sequence N:  ARSAYSYIREAWKRPKEGQIAELMWHRMQEWRNEPAVVRI ERPTRLDRARSLGYKAKQGIIVVRVAIRKGSSRRTRFNKG RRSKRMMVNRITRKKNIQRIAEERANRKFPNLRVLNSYSV GEDGRHKWHEVILIDPDHPAIKSDDQLSWISRTRHRLRTF RGLTSAGRRCRGLRGQGKGSEKVRPSLRVNGAKA Description Functional site 1) chain N residue 82 type sequence R description BINDING SITE FOR RESIDUE K A 8201 source : MC4 2) chain N residue 193 type sequence K description BINDING SITE FOR RESIDUE NA A 8365 source : SC3 3) chain N residue 194 type sequence A description BINDING SITE FOR RESIDUE NA A 8365 source : SC3 4) chain N residue 106 type sequence N description BINDING SITE FOR RESIDUE NA N 8347 source : XC5 5) chain N residue 109 type sequence F description BINDING SITE FOR RESIDUE NA N 8347 source : XC5 6) chain N residue 110 type sequence P description BINDING SITE FOR RESIDUE NA N 8347 source : XC5 7) chain N residue 112 type sequence L description BINDING SITE FOR RESIDUE NA N 8347 source : XC5 8) chain N residue 106 type sequence N description BINDING SITE FOR RESIDUE CL N 8518 source : XC6 9) chain N residue 114 type sequence V description BINDING SITE FOR RESIDUE CL N 8518 source : XC6 10) chain N residue 157 type sequence L description BINDING SITE FOR RESIDUE CL N 8518 source : XC6 11) chain N residue 158 type sequence R description BINDING SITE FOR RESIDUE CL N 8518 source : XC6 12) chain N residue 159 type sequence T description BINDING SITE FOR RESIDUE CL N 8518 source : XC6 13) chain N residue 47-70 type prosite sequence DRARSLGYKAKQGIIVVRVAIRKG description RIBOSOMAL_L15E Ribosomal protein L15e signature. DRARsLGYkAkqGIIVVRvAIrKG source prosite : PS01194

Display surface Download Links