eF-site ID 1k6t-AB PDB Code 1k6t Chain A, B click to enlarge Title LACK OF SYNERGY FOR INHIBITORS TARGETING A MULTI-DRUG RESISTANT HIV-1 PROTEASE Classification HYDROLASE Compound POL polyprotein Source Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) (HIV-1) (POL_HV1Y2) Sequence A:  PQITLWKRPLVTIRIGGQLKEALLDTGADDTVLEEMNLPG RWKPKMIGGIGGFIKVRQYDQIPIEICGHKAIGTVLVGPT PTNVIGRNLLTQIGCTLNF B:  PQITLWKRPLVTIRIGGQLKEALLDTGADDTVLEEMNLPG RWKPKMIGGIGGFIKVRQYDQIPIEICGHKAIGTVLVGPT PTNVIGRNLLTQIGCTLNF Description Functional site 1) chain A residue 1 type sequence P description BINDING SITE FOR RESIDUE ACT A 502 source : AC1 2) chain B residue 69 type sequence H description BINDING SITE FOR RESIDUE ACT A 502 source : AC1 3) chain B residue 70 type sequence K description BINDING SITE FOR RESIDUE ACT A 502 source : AC1 4) chain A residue 7 type sequence K description BINDING SITE FOR RESIDUE ACT A 503 source : AC2 5) chain A residue 8 type sequence R description BINDING SITE FOR RESIDUE ACT A 503 source : AC2 6) chain B residue 87 type sequence R description BINDING SITE FOR RESIDUE ACT A 503 source : AC2 7) chain A residue 16 type sequence G description BINDING SITE FOR RESIDUE ACT A 506 source : AC3 8) chain A residue 17 type sequence G description BINDING SITE FOR RESIDUE ACT A 506 source : AC3 9) chain B residue 14 type sequence R description BINDING SITE FOR RESIDUE ACT A 506 source : AC3 10) chain B residue 17 type sequence G description BINDING SITE FOR RESIDUE ACT A 506 source : AC3 11) chain B residue 1 type sequence P description BINDING SITE FOR RESIDUE ACT B 508 source : AC4 12) chain B residue 57 type sequence R description BINDING SITE FOR RESIDUE ACT B 508 source : AC4 13) chain B residue 69 type sequence H description BINDING SITE FOR RESIDUE ACT B 508 source : AC4 14) chain A residue 6 type sequence W description BINDING SITE FOR RESIDUE XN1 B 509 source : AC5 15) chain A residue 8 type sequence R description BINDING SITE FOR RESIDUE XN1 B 509 source : AC5 16) chain A residue 25 type sequence D description BINDING SITE FOR RESIDUE XN1 B 509 source : AC5 17) chain A residue 48 type sequence G description BINDING SITE FOR RESIDUE XN1 B 509 source : AC5 18) chain A residue 49 type sequence G description BINDING SITE FOR RESIDUE XN1 B 509 source : AC5 19) chain A residue 50 type sequence I description BINDING SITE FOR RESIDUE XN1 B 509 source : AC5 20) chain A residue 84 type sequence V description BINDING SITE FOR RESIDUE XN1 B 509 source : AC5 21) chain B residue 25 type sequence D description BINDING SITE FOR RESIDUE XN1 B 509 source : AC5 22) chain B residue 27 type sequence G description BINDING SITE FOR RESIDUE XN1 B 509 source : AC5 23) chain B residue 28 type sequence A description BINDING SITE FOR RESIDUE XN1 B 509 source : AC5 24) chain B residue 29 type sequence D description BINDING SITE FOR RESIDUE XN1 B 509 source : AC5 25) chain B residue 30 type sequence D description BINDING SITE FOR RESIDUE XN1 B 509 source : AC5 26) chain B residue 32 type sequence V description BINDING SITE FOR RESIDUE XN1 B 509 source : AC5 27) chain B residue 48 type sequence G description BINDING SITE FOR RESIDUE XN1 B 509 source : AC5 28) chain B residue 50 type sequence I description BINDING SITE FOR RESIDUE XN1 B 509 source : AC5 29) chain B residue 81 type sequence P description BINDING SITE FOR RESIDUE XN1 B 509 source : AC5 30) chain A residue 22-33 type prosite sequence ALLDTGADDTVL description ASP_PROTEASE Eukaryotic and viral aspartyl proteases active site. ALLDTGADDTVL source prosite : PS00141 31) chain A residue 76 type SITE sequence L description Cleavage; by viral protease => ECO:0000250 source Swiss-Prot : SWS_FT_FI1 32) chain B residue 76 type SITE sequence L description Cleavage; by viral protease => ECO:0000250 source Swiss-Prot : SWS_FT_FI1 33) chain A residue 76 type MOD_RES sequence L description Phosphotyrosine; by host => ECO:0000250 source Swiss-Prot : SWS_FT_FI2 34) chain B residue 76 type MOD_RES sequence L description Phosphotyrosine; by host => ECO:0000250 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links