eF-site ID 1k6t-A PDB Code 1k6t Chain A click to enlarge Title LACK OF SYNERGY FOR INHIBITORS TARGETING A MULTI-DRUG RESISTANT HIV-1 PROTEASE Classification HYDROLASE Compound POL polyprotein Source null (POL_HV1Y2) Sequence A:  PQITLWKRPLVTIRIGGQLKEALLDTGADDTVLEEMNLPG RWKPKMIGGIGGFIKVRQYDQIPIEICGHKAIGTVLVGPT PTNVIGRNLLTQIGCTLNF Description Functional site 1) chain A residue 1 type sequence P description BINDING SITE FOR RESIDUE ACT A 502 source : AC1 2) chain A residue 7 type sequence K description BINDING SITE FOR RESIDUE ACT A 503 source : AC2 3) chain A residue 8 type sequence R description BINDING SITE FOR RESIDUE ACT A 503 source : AC2 4) chain A residue 16 type sequence G description BINDING SITE FOR RESIDUE ACT A 506 source : AC3 5) chain A residue 17 type sequence G description BINDING SITE FOR RESIDUE ACT A 506 source : AC3 6) chain A residue 6 type sequence W description BINDING SITE FOR RESIDUE XN1 B 509 source : AC5 7) chain A residue 8 type sequence R description BINDING SITE FOR RESIDUE XN1 B 509 source : AC5 8) chain A residue 25 type sequence D description BINDING SITE FOR RESIDUE XN1 B 509 source : AC5 9) chain A residue 48 type sequence G description BINDING SITE FOR RESIDUE XN1 B 509 source : AC5 10) chain A residue 49 type sequence G description BINDING SITE FOR RESIDUE XN1 B 509 source : AC5 11) chain A residue 50 type sequence I description BINDING SITE FOR RESIDUE XN1 B 509 source : AC5 12) chain A residue 84 type sequence V description BINDING SITE FOR RESIDUE XN1 B 509 source : AC5 13) chain A residue 76 type SITE sequence L description Cleavage; by viral protease => ECO:0000250 source Swiss-Prot : SWS_FT_FI1 14) chain A residue 76 type MOD_RES sequence L description Phosphotyrosine; by host => ECO:0000250 source Swiss-Prot : SWS_FT_FI2 15) chain A residue 22-33 type prosite sequence ALLDTGADDTVL description ASP_PROTEASE Eukaryotic and viral aspartyl proteases active site. ALLDTGADDTVL source prosite : PS00141

Display surface Download Links