eF-site ID 1jz6-A PDB Code 1jz6 Chain A click to enlarge Title E. COLI (lacZ) BETA-GALACTOSIDASE IN COMPLEX WITH GALACTO-TETRAZOLE Classification HYDROLASE Compound Beta-Galactosidase Source Escherichia coli (strain K12) (BGAL_ECOLI) Sequence A:  RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR SLNGEWRFAWFPAPEAVPESWLECDLPEADTVVVPSNWQM HGYDAPIYTNVTYPITVNPPFVPTENPTGCYSLTFNVDES WLQEGQTRIIFDGVNSAFHLWCNGRWVGYGQDSRLPSEFD LSAFLRAGENRLAVMVLRWSDGSYLEDQDMWRMSGIFRDV SLLHKPTTQISDFHVATRFNDDFSRAVLEAEVQMCGELRD YLRVTVSLWQGETQVASGTAPFGGEIIDERGGYADRVTLR LNVENPKLWSAEIPNLYRAVVELHTADGTLIEAEACDVGF REVRIENGLLLLNGKPLLIRGVNRHEHHPLHGQVMDEQTM VQDILLMKQNNFNAVRCSHYPNHPLWYTLCDRYGLYVVDE ANIETHGMVPMNRLTDDPRWLPAMSERVTRMVQRDRNHPS VIIWSLGNESGHGANHDALYRWIKSVDPSRPVQYEGGGAD TTATDIICPMYARVDEDQPFPAVPKWSIKKWLSLPGETRP LILCEYAHAMGNSLGGFAKYWQAFRQYPRLQGGFVWDWVD QSLIKYDENGNPWSAYGGDFGDTPNDRQFCMNGLVFADRT PHPALTEAKHQQQFFQFRLSGQTIEVTSEYLFRHSDNELL HWMVALDGKPLASGEVPLDVAPQGKQLIELPELPQPESAG QLWLTVRVVQPNATAWSEAGHISAWQQWRLAENLSVTLPA ASHAIPHLTTSEMDFCIELGNKRWQFNRQSGFLSQMWIGD KKQLLTPLRDQFTRAPLDNDIGVSEATRIDPNAWVERWKA AGHYQAEAALLQCTADTLADAVLITTAHAWQHQGKTLFIS RKTYRIDGSGQMAITVDVEVASDTPHPARIGLNCQLAQVA ERVNWLGLGPQENYPDRLTAACFDRWDLPLSDMYTPYVFP SENGLRCGTRELNYGPHQWRGDFQFNISRYSQQQLMETSH RHLLHAEEGTWLNIDGFHMGIGGDDSWSPSVSAEFQLSAG RYHYQLVWCQK Description Functional site 1) chain A residue 201 type sequence D description BINDING SITE FOR RESIDUE GTZ A 2001 source : AC1 2) chain A residue 391 type sequence H description BINDING SITE FOR RESIDUE GTZ A 2001 source : AC1 3) chain A residue 460 type sequence N description BINDING SITE FOR RESIDUE GTZ A 2001 source : AC1 4) chain A residue 461 type sequence E description BINDING SITE FOR RESIDUE GTZ A 2001 source : AC1 5) chain A residue 502 type sequence M description BINDING SITE FOR RESIDUE GTZ A 2001 source : AC1 6) chain A residue 503 type sequence Y description BINDING SITE FOR RESIDUE GTZ A 2001 source : AC1 7) chain A residue 537 type sequence E description BINDING SITE FOR RESIDUE GTZ A 2001 source : AC1 8) chain A residue 540 type sequence H description BINDING SITE FOR RESIDUE GTZ A 2001 source : AC1 9) chain A residue 568 type sequence W description BINDING SITE FOR RESIDUE GTZ A 2001 source : AC1 10) chain A residue 604 type sequence N description BINDING SITE FOR RESIDUE GTZ A 2001 source : AC1 11) chain A residue 999 type sequence W description BINDING SITE FOR RESIDUE GTZ A 2001 source : AC1 12) chain A residue 416 type sequence E description BINDING SITE FOR RESIDUE MG A 3001 source : AC5 13) chain A residue 418 type sequence H description BINDING SITE FOR RESIDUE MG A 3001 source : AC5 14) chain A residue 461 type sequence E description BINDING SITE FOR RESIDUE MG A 3001 source : AC5 15) chain A residue 15 type sequence D description BINDING SITE FOR RESIDUE MG A 3002 source : AC6 16) chain A residue 18 type sequence N description BINDING SITE FOR RESIDUE MG A 3002 source : AC6 17) chain A residue 21 type sequence V description BINDING SITE FOR RESIDUE MG A 3002 source : AC6 18) chain A residue 163 type sequence Q description BINDING SITE FOR RESIDUE MG A 3002 source : AC6 19) chain A residue 193 type sequence D description BINDING SITE FOR RESIDUE MG A 3002 source : AC6 20) chain A residue 201 type sequence D description BINDING SITE FOR RESIDUE NA A 3101 source : AC8 21) chain A residue 601 type sequence F description BINDING SITE FOR RESIDUE NA A 3101 source : AC8 22) chain A residue 604 type sequence N description BINDING SITE FOR RESIDUE NA A 3101 source : AC8 23) chain A residue 556 type sequence F description BINDING SITE FOR RESIDUE NA A 3102 source : AC9 24) chain A residue 559 type sequence Y description BINDING SITE FOR RESIDUE NA A 3102 source : AC9 25) chain A residue 560 type sequence P description BINDING SITE FOR RESIDUE NA A 3102 source : AC9 26) chain A residue 562 type sequence L description BINDING SITE FOR RESIDUE NA A 3102 source : AC9 27) chain A residue 931 type sequence F description BINDING SITE FOR RESIDUE NA A 3103 source : BC1 28) chain A residue 932 type sequence P description BINDING SITE FOR RESIDUE NA A 3103 source : BC1 29) chain A residue 967 type sequence L description BINDING SITE FOR RESIDUE NA A 3103 source : BC1 30) chain A residue 970 type sequence T description BINDING SITE FOR RESIDUE NA A 3103 source : BC1 31) chain A residue 647 type sequence S description BINDING SITE FOR RESIDUE MG A 3105 source : BC2 32) chain A residue 650 type sequence E description BINDING SITE FOR RESIDUE MG A 3105 source : BC2 33) chain A residue 670 type sequence L description BINDING SITE FOR RESIDUE MG A 3105 source : BC2 34) chain A residue 229 type sequence T description BINDING SITE FOR RESIDUE DMS A 8401 source : DC2 35) chain A residue 330 type sequence V description BINDING SITE FOR RESIDUE DMS A 8401 source : DC2 36) chain A residue 331 type sequence G description BINDING SITE FOR RESIDUE DMS A 8401 source : DC2 37) chain A residue 449 type sequence N description BINDING SITE FOR RESIDUE DMS A 8401 source : DC2 38) chain A residue 451 type sequence P description BINDING SITE FOR RESIDUE DMS A 8401 source : DC2 39) chain A residue 557 type sequence R description BINDING SITE FOR RESIDUE DMS A 8402 source : DC3 40) chain A residue 622 type sequence H description BINDING SITE FOR RESIDUE DMS A 8402 source : DC3 41) chain A residue 623 type sequence Q description BINDING SITE FOR RESIDUE DMS A 8402 source : DC3 42) chain A residue 625 type sequence Q description BINDING SITE FOR RESIDUE DMS A 8402 source : DC3 43) chain A residue 628 type sequence Q description BINDING SITE FOR RESIDUE DMS A 8402 source : DC3 44) chain A residue 380 type sequence K description BINDING SITE FOR RESIDUE DMS A 8403 source : DC4 45) chain A residue 383 type sequence N description BINDING SITE FOR RESIDUE DMS A 8403 source : DC4 46) chain A residue 626 type sequence F description BINDING SITE FOR RESIDUE DMS A 8403 source : DC4 47) chain A residue 642 type sequence Y description BINDING SITE FOR RESIDUE DMS A 8403 source : DC4 48) chain A residue 708 type sequence W description BINDING SITE FOR RESIDUE DMS A 8403 source : DC4 49) chain A residue 32 type sequence P description BINDING SITE FOR RESIDUE DMS A 8404 source : DC5 50) chain A residue 33 type sequence F description BINDING SITE FOR RESIDUE DMS A 8404 source : DC5 51) chain A residue 327 type sequence A description BINDING SITE FOR RESIDUE DMS A 8404 source : DC5 52) chain A residue 271 type sequence T description BINDING SITE FOR RESIDUE DMS A 8405 source : DC6 53) chain A residue 290 type sequence T description BINDING SITE FOR RESIDUE DMS A 8405 source : DC6 54) chain A residue 291 type sequence L description BINDING SITE FOR RESIDUE DMS A 8405 source : DC6 55) chain A residue 292 type sequence R description BINDING SITE FOR RESIDUE DMS A 8405 source : DC6 56) chain A residue 314 type sequence E description BINDING SITE FOR RESIDUE DMS A 8406 source : DC7 57) chain A residue 316 type sequence H description BINDING SITE FOR RESIDUE DMS A 8406 source : DC7 58) chain A residue 320 type sequence G description BINDING SITE FOR RESIDUE DMS A 8406 source : DC7 59) chain A residue 508 type sequence E description BINDING SITE FOR RESIDUE DMS A 8407 source : DC8 60) chain A residue 1001 type sequence P description BINDING SITE FOR RESIDUE DMS A 8407 source : DC8 61) chain A residue 1003 type sequence V description BINDING SITE FOR RESIDUE DMS A 8407 source : DC8 62) chain A residue 54 type sequence L description BINDING SITE FOR RESIDUE DMS A 8408 source : DC9 63) chain A residue 55 type sequence N description BINDING SITE FOR RESIDUE DMS A 8408 source : DC9 64) chain A residue 127 type sequence F description BINDING SITE FOR RESIDUE DMS A 8408 source : DC9 65) chain A residue 334 type sequence E description BINDING SITE FOR RESIDUE DMS A 8409 source : EC1 66) chain A residue 335 type sequence V description BINDING SITE FOR RESIDUE DMS A 8409 source : EC1 67) chain A residue 106 type sequence P description BINDING SITE FOR RESIDUE DMS A 8410 source : EC2 68) chain A residue 115 type sequence P description BINDING SITE FOR RESIDUE DMS A 8410 source : EC2 69) chain A residue 191 type sequence W description BINDING SITE FOR RESIDUE DMS A 8410 source : EC2 70) chain A residue 576 type sequence I description BINDING SITE FOR RESIDUE DMS A 8411 source : EC3 71) chain A residue 585 type sequence W description BINDING SITE FOR RESIDUE DMS A 8411 source : EC3 72) chain A residue 586 type sequence S description BINDING SITE FOR RESIDUE DMS A 8411 source : EC3 73) chain A residue 973 type sequence R description BINDING SITE FOR RESIDUE DMS A 8411 source : EC3 74) chain A residue 277 type sequence E description BINDING SITE FOR RESIDUE DMS A 8412 source : EC4 75) chain A residue 290 type sequence T description BINDING SITE FOR RESIDUE DMS A 8412 source : EC4 76) chain A residue 292 type sequence R description BINDING SITE FOR RESIDUE DMS A 8412 source : EC4 77) chain A residue 84 type sequence V description BINDING SITE FOR RESIDUE DMS A 8414 source : EC5 78) chain A residue 85 type sequence V description BINDING SITE FOR RESIDUE DMS A 8414 source : EC5 79) chain A residue 93 type sequence H description BINDING SITE FOR RESIDUE DMS A 8414 source : EC5 80) chain A residue 231 type sequence F description BINDING SITE FOR RESIDUE DMS A 8417 source : EC6 81) chain A residue 232 type sequence N description BINDING SITE FOR RESIDUE DMS A 8417 source : EC6 82) chain A residue 334 type sequence E description BINDING SITE FOR RESIDUE DMS A 8417 source : EC6 83) chain A residue 428 type sequence D description BINDING SITE FOR RESIDUE DMS A 8420 source : EC7 84) chain A residue 94 type sequence G description BINDING SITE FOR RESIDUE DMS A 8421 source : EC8 85) chain A residue 95 type sequence Y description BINDING SITE FOR RESIDUE DMS A 8421 source : EC8 86) chain A residue 647 type sequence S description BINDING SITE FOR RESIDUE DMS A 8425 source : EC9 87) chain A residue 648 type sequence D description BINDING SITE FOR RESIDUE DMS A 8425 source : EC9 88) chain A residue 649 type sequence N description BINDING SITE FOR RESIDUE DMS A 8425 source : EC9 89) chain A residue 650 type sequence E description BINDING SITE FOR RESIDUE DMS A 8425 source : EC9 90) chain A residue 704 type sequence N description BINDING SITE FOR RESIDUE DMS A 8425 source : EC9 91) chain A residue 36 type sequence W description BINDING SITE FOR RESIDUE DMS A 8501 source : FC1 92) chain A residue 45 type sequence D description BINDING SITE FOR RESIDUE DMS A 8501 source : FC1 93) chain A residue 46 type sequence R description BINDING SITE FOR RESIDUE DMS A 8501 source : FC1 94) chain A residue 47 type sequence P description BINDING SITE FOR RESIDUE DMS A 8501 source : FC1 95) chain A residue 48 type sequence S description BINDING SITE FOR RESIDUE DMS A 8501 source : FC1 96) chain A residue 136 type sequence E description BINDING SITE FOR RESIDUE DMS A 8504 source : FC2 97) chain A residue 216 type sequence H description BINDING SITE FOR RESIDUE DMS A 8504 source : FC2 98) chain A residue 136 type sequence E description BINDING SITE FOR RESIDUE DMS D 8406 source : JC9 99) chain A residue 136 type sequence E description BINDING SITE FOR RESIDUE DMS D 8701 source : LC1 100) chain A residue 323 type sequence I description BINDING SITE FOR RESIDUE DMS D 8701 source : LC1 101) chain A residue 202 type catalytic sequence M description 422 source MCSA : MCSA1 102) chain A residue 605 type catalytic sequence G description 422 source MCSA : MCSA1 103) chain A residue 358 type catalytic sequence E description 422 source MCSA : MCSA1 104) chain A residue 392 type catalytic sequence Y description 422 source MCSA : MCSA1 105) chain A residue 417 type catalytic sequence T description 422 source MCSA : MCSA1 106) chain A residue 419 type catalytic sequence G description 422 source MCSA : MCSA1 107) chain A residue 462 type catalytic sequence S description 422 source MCSA : MCSA1 108) chain A residue 538 type catalytic sequence Y description 422 source MCSA : MCSA1 109) chain A residue 598 type catalytic sequence D description 422 source MCSA : MCSA1 110) chain A residue 602 type catalytic sequence C description 422 source MCSA : MCSA1 111) chain A residue 462 type ACT_SITE sequence S description Proton donor => ECO:0000269|PubMed:6420154 source Swiss-Prot : SWS_FT_FI1 112) chain A residue 538 type ACT_SITE sequence Y description Nucleophile => ECO:0000269|PubMed:1350782 source Swiss-Prot : SWS_FT_FI2 113) chain A residue 103 type BINDING sequence V description source Swiss-Prot : SWS_FT_FI3 114) chain A residue 202 type BINDING sequence M description source Swiss-Prot : SWS_FT_FI3 115) chain A residue 462 type BINDING sequence S description source Swiss-Prot : SWS_FT_FI3 116) chain A residue 538 type BINDING sequence Y description source Swiss-Prot : SWS_FT_FI3 117) chain A residue 602 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI3 118) chain A residue 605 type BINDING sequence G description source Swiss-Prot : SWS_FT_FI3 119) chain A residue 1000 type BINDING sequence S description source Swiss-Prot : SWS_FT_FI3 120) chain A residue 417 type BINDING sequence T description BINDING => ECO:0000269|PubMed:11045615 source Swiss-Prot : SWS_FT_FI4 121) chain A residue 419 type BINDING sequence G description BINDING => ECO:0000269|PubMed:11045615 source Swiss-Prot : SWS_FT_FI4 122) chain A residue 598 type BINDING sequence D description BINDING => ECO:0000269|PubMed:11045615 source Swiss-Prot : SWS_FT_FI4 123) chain A residue 358 type SITE sequence E description Transition state stabilizer source Swiss-Prot : SWS_FT_FI5 124) chain A residue 392 type SITE sequence Y description Transition state stabilizer source Swiss-Prot : SWS_FT_FI5 125) chain A residue 1000 type SITE sequence S description Important for ensuring that an appropriate proportion of lactose is converted to allolactose source Swiss-Prot : SWS_FT_FI6 126) chain A residue 447-461 type prosite sequence DRNHPSVIIWSLGNE description GLYCOSYL_HYDROL_F2_2 Glycosyl hydrolases family 2 acid/base catalyst. DRNHPSVIIWSlg.NE source prosite : PS00608 127) chain A residue 385-410 type prosite sequence NAVRCSHYPNHPLWYTLCDRYGLYVV description GLYCOSYL_HYDROL_F2_1 Glycosyl hydrolases family 2 signature 1. NaVRCSHYPnhplWYtlcDryGLYVV source prosite : PS00719

Display surface Download Links