eF-site ID 1jyl-A PDB Code 1jyl Chain A click to enlarge Title Catalytic Mechanism of CTP:phosphocholine Cytidylyltransferase from Streptococcus pneumoniae (LicC) Classification TRANSFERASE Compound CTP:phosphocholine Cytidylyltransferase Source Streptococcus pneumoniae (Q97QE9_STRPN) Sequence A:  IRVKAIILAAGLGTRLRPLTENTPKALVQVNQKPLIEYQI EFLKEKGINDIIIIVGYLKEQFDYLKEKYGVRLVFNDKYA DYNNFYSLYLVKEELANSYVIDADNYLFKNMFRNDLTRST YFSVYREDCTNEWFLVYGDDYKVQDIIVDSKAGRILSGVS FWDAPTAEKIVSFIDKAYVSGEFVDLYWDNMVKDNIKELD VYVEELEGNSIYEIDSVQDYRKLEEILK Description Functional site 1) chain A residue 107 type sequence D description BINDING SITE FOR RESIDUE MG A 1996 source : AC1 2) chain A residue 216 type sequence E description BINDING SITE FOR RESIDUE MG A 1996 source : AC1 3) chain A residue 218 type sequence D description BINDING SITE FOR RESIDUE MG A 1996 source : AC1 4) chain A residue 11 type sequence L description BINDING SITE FOR RESIDUE CDC A 1991 source : AC5 5) chain A residue 12 type sequence A description BINDING SITE FOR RESIDUE CDC A 1991 source : AC5 6) chain A residue 13 type sequence A description BINDING SITE FOR RESIDUE CDC A 1991 source : AC5 7) chain A residue 14 type sequence G description BINDING SITE FOR RESIDUE CDC A 1991 source : AC5 8) chain A residue 82 type sequence Y description BINDING SITE FOR RESIDUE CDC A 1991 source : AC5 9) chain A residue 85 type sequence Y description BINDING SITE FOR RESIDUE CDC A 1991 source : AC5 10) chain A residue 86 type sequence N description BINDING SITE FOR RESIDUE CDC A 1991 source : AC5 11) chain A residue 87 type sequence N description BINDING SITE FOR RESIDUE CDC A 1991 source : AC5 12) chain A residue 90 type sequence S description BINDING SITE FOR RESIDUE CDC A 1991 source : AC5 13) chain A residue 106 type sequence A description BINDING SITE FOR RESIDUE CDC A 1991 source : AC5 14) chain A residue 107 type sequence D description BINDING SITE FOR RESIDUE CDC A 1991 source : AC5 15) chain A residue 136 type sequence W description BINDING SITE FOR RESIDUE CDC A 1991 source : AC5 16) chain A residue 190 type sequence Y description BINDING SITE FOR RESIDUE CDC A 1991 source : AC5 17) chain A residue 192 type sequence D description BINDING SITE FOR RESIDUE CDC A 1991 source : AC5 18) chain A residue 216 type sequence E description BINDING SITE FOR RESIDUE CDC A 1991 source : AC5 19) chain A residue 218 type sequence D description BINDING SITE FOR RESIDUE CDC A 1991 source : AC5 20) chain A residue 21 type sequence P description BINDING SITE FOR RESIDUE CDC B 2991 source : AC6 21) chain A residue 11 type BINDING sequence L description BINDING => ECO:0000269|PubMed:11706035, ECO:0007744|PDB:1JYL source Swiss-Prot : SWS_FT_FI1 22) chain A residue 216 type BINDING sequence E description BINDING => ECO:0000269|PubMed:11706035, ECO:0007744|PDB:1JYL source Swiss-Prot : SWS_FT_FI1 23) chain A residue 218 type BINDING sequence D description BINDING => ECO:0000269|PubMed:11706035, ECO:0007744|PDB:1JYL source Swiss-Prot : SWS_FT_FI1 24) chain A residue 13 type BINDING sequence A description BINDING => ECO:0000269|PubMed:11706035, ECO:0007744|PDB:1JYL source Swiss-Prot : SWS_FT_FI1 25) chain A residue 14 type BINDING sequence G description BINDING => ECO:0000269|PubMed:11706035, ECO:0007744|PDB:1JYL source Swiss-Prot : SWS_FT_FI1 26) chain A residue 85 type BINDING sequence Y description BINDING => ECO:0000269|PubMed:11706035, ECO:0007744|PDB:1JYL source Swiss-Prot : SWS_FT_FI1 27) chain A residue 87 type BINDING sequence N description BINDING => ECO:0000269|PubMed:11706035, ECO:0007744|PDB:1JYL source Swiss-Prot : SWS_FT_FI1 28) chain A residue 90 type BINDING sequence S description BINDING => ECO:0000269|PubMed:11706035, ECO:0007744|PDB:1JYL source Swiss-Prot : SWS_FT_FI1 29) chain A residue 106 type BINDING sequence A description BINDING => ECO:0000269|PubMed:11706035, ECO:0007744|PDB:1JYL source Swiss-Prot : SWS_FT_FI1 30) chain A residue 107 type BINDING sequence D description BINDING => ECO:0000269|PubMed:11706035, ECO:0007744|PDB:1JYL source Swiss-Prot : SWS_FT_FI1 31) chain A residue 190 type BINDING sequence Y description BINDING => ECO:0000269|PubMed:11706035, ECO:0007744|PDB:1JYL source Swiss-Prot : SWS_FT_FI1

Display surface Download Links