eF-site ID 1jyf-A
PDB Code 1jyf
Chain A

click to enlarge
Title Structure of the Dimeric Lac Repressor with an 11-residue C-terminal Deletion.
Classification TRANSCRIPTION
Compound Lactose Operon Repressor
Source Escherichia coli (strain K12) (LACI_ECOLI)
Sequence A:  LLIGVATSSLALHAPSQIVAAIKSRADQLGASVVVSMVER
SGVEACKTAVHNLLAQRVSGLIINYPLDDQDAIAVEAACT
NVPALFLDVSDQTPINSIIFSHEDGTRLGVEHLVALGHQQ
IALLAGPLSSVSARLRLAGWHKYLTRNQIQPIAEREGDWS
AMSGFQQTMQMLNEGIVPTAMLVANDQMALGAMRAITESG
LRVGADISVVGYDDTEDSSCYIPPLTTIKQDFRLLGQTSV
DRLLQLSQGQAVKGNQLLPVSLVKRKTTLAPN
Description (1)  Lactose Operon Repressor


Functional site

1) chain A
residue 75
type
ligand
sequence A
description BINDING SITE FOR RESIDUE GOL A 350
source : AC1

2) chain A
residue 193
type
ligand
sequence S
description BINDING SITE FOR RESIDUE GOL A 350
source : AC1

3) chain A
residue 197
type
ligand
sequence R
description BINDING SITE FOR RESIDUE GOL A 350
source : AC1

4) chain A
residue 246
type
ligand
sequence N
description BINDING SITE FOR RESIDUE GOL A 350
source : AC1

5) chain A
residue 274
type
ligand
sequence D
description BINDING SITE FOR RESIDUE GOL A 350
source : AC1

6) chain A
residue 291
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE GOL A 350
source : AC1

7) chain A
residue 75
type binding
ligand GOL: GLYCEROL
sequence A
description GLYCEROL binding site
source pdb_hetatom : GOL_1jyf_A_350

8) chain A
residue 149
type binding
ligand GOL: GLYCEROL
sequence D
description GLYCEROL binding site
source pdb_hetatom : GOL_1jyf_A_350

9) chain A
residue 193
type binding
ligand GOL: GLYCEROL
sequence S
description GLYCEROL binding site
source pdb_hetatom : GOL_1jyf_A_350

10) chain A
residue 197
type binding
ligand GOL: GLYCEROL
sequence R
description GLYCEROL binding site
source pdb_hetatom : GOL_1jyf_A_350

11) chain A
residue 220
type binding
ligand GOL: GLYCEROL
sequence W
description GLYCEROL binding site
source pdb_hetatom : GOL_1jyf_A_350

12) chain A
residue 245-246
type binding
ligand GOL: GLYCEROL
sequence AN
description GLYCEROL binding site
source pdb_hetatom : GOL_1jyf_A_350

13) chain A
residue 273-274
type binding
ligand GOL: GLYCEROL
sequence YD
description GLYCEROL binding site
source pdb_hetatom : GOL_1jyf_A_350

14) chain A
residue 291
type binding
ligand GOL: GLYCEROL
sequence Q
description GLYCEROL binding site
source pdb_hetatom : GOL_1jyf_A_350


Display surface

Download
Links