eF-site ID 1jwv-A PDB Code 1jwv Chain A click to enlarge Title Crystal structure of G238A mutant of TEM-1 beta-lactamase in complex with a boronic acid inhibitor (sefb4) Classification HYDROLASE Compound BETA-LACTAMASE TEM Source Escherichia coli (BLAT_ECOLI) Sequence A:  HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEER FPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEY SPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGP KELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTMPAA MATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSAL PAGWFIADKSGAAERGSRGIIAALGPDGKPSRIVVIYTTG SQATMDERNRQIAEIGASLIKHW Description Functional site 1) chain A residue 97 type sequence Y description BINDING SITE FOR RESIDUE K A 1 source : AC1 2) chain A residue 113 type sequence L description BINDING SITE FOR RESIDUE K A 1 source : AC1 3) chain A residue 57 type sequence L description BINDING SITE FOR RESIDUE K A 2 source : AC2 4) chain A residue 58 type sequence E description BINDING SITE FOR RESIDUE K A 2 source : AC2 5) chain A residue 100 type sequence N description BINDING SITE FOR RESIDUE K A 2 source : AC2 6) chain A residue 57 type sequence L description BINDING SITE FOR RESIDUE K A 3 source : AC3 7) chain A residue 58 type sequence E description BINDING SITE FOR RESIDUE K A 3 source : AC3 8) chain A residue 111 type sequence K description BINDING SITE FOR RESIDUE K A 4 source : AC4 9) chain A residue 113 type sequence L description BINDING SITE FOR RESIDUE K A 4 source : AC4 10) chain A residue 114 type sequence T description BINDING SITE FOR RESIDUE K A 4 source : AC4 11) chain A residue 69 type sequence M description BINDING SITE FOR RESIDUE CB4 A 300 source : AC6 12) chain A residue 70 type sequence S description BINDING SITE FOR RESIDUE CB4 A 300 source : AC6 13) chain A residue 105 type sequence Y description BINDING SITE FOR RESIDUE CB4 A 300 source : AC6 14) chain A residue 130 type sequence S description BINDING SITE FOR RESIDUE CB4 A 300 source : AC6 15) chain A residue 132 type sequence N description BINDING SITE FOR RESIDUE CB4 A 300 source : AC6 16) chain A residue 236 type sequence G description BINDING SITE FOR RESIDUE CB4 A 300 source : AC6 17) chain A residue 237 type sequence A description BINDING SITE FOR RESIDUE CB4 A 300 source : AC6 18) chain A residue 238 type sequence A description BINDING SITE FOR RESIDUE CB4 A 300 source : AC6 19) chain A residue 240 type sequence E description BINDING SITE FOR RESIDUE CB4 A 300 source : AC6 20) chain A residue 70 type catalytic sequence S description 2 source MCSA : MCSA1 21) chain A residue 73 type catalytic sequence K description 2 source MCSA : MCSA1 22) chain A residue 130 type catalytic sequence S description 2 source MCSA : MCSA1 23) chain A residue 166 type catalytic sequence E description 2 source MCSA : MCSA1 24) chain A residue 234 type catalytic sequence K description 2 source MCSA : MCSA1 25) chain A residue 237 type catalytic sequence A description 2 source MCSA : MCSA1 26) chain A residue 66-81 type prosite sequence FPMMSTFKVLLCGAVL description BETA_LACTAMASE_A Beta-lactamase class-A active site. FpMMSTfKvllCGAVL source prosite : PS00146 27) chain A residue 70 type ACT_SITE sequence S description Acyl-ester intermediate source Swiss-Prot : SWS_FT_FI1 28) chain A residue 168 type ACT_SITE sequence E description Proton acceptor source Swiss-Prot : SWS_FT_FI2 29) chain A residue 234 type BINDING sequence K description source Swiss-Prot : SWS_FT_FI3

Display surface Download Links