eF-site ID 1jqv-A PDB Code 1jqv Chain A click to enlarge Title The K213E mutant of Lactococcus lactis Dihydroorotate dehydrogenase A Classification OXIDOREDUCTASE Compound Dihydroorotate dehydrogenase A Source null (PYRDA_LACLC) Sequence A:  MLNTTFANAKFANPFMNASGVHCMTIEDLEELKASQAGAY ITKSSTLEKREGNPLPRYVDLELGSINSMGLPNLGFDYYL DYVLKNQKENAQEGPIFFSIAGMSAAENIAMLKKIQESDF SGITELNLSCPNVPGKPQLAYDFEATEKLLKEVFTFFTKP LGVKLPPYFDLVHFDIMAEILNQFPLTYVNSVNSIGNGLF IDPEAESVVIKPEDGFGGIGGAYIKPTALANVRAFYTRLK PEIQIIGTGGIETGQDAFEHLLCGATMLQIGTALHKEGPA IFDRIIKELEEIMNQKGYQSIADFHGKLKSL Description Functional site 1) chain A residue 33 type sequence K description BINDING SITE FOR RESIDUE MG A 314 source : AC1 2) chain A residue 35 type sequence S description BINDING SITE FOR RESIDUE MG A 314 source : AC1 3) chain A residue 18 type sequence A description BINDING SITE FOR RESIDUE FMN A 1312 source : AC3 4) chain A residue 19 type sequence S description BINDING SITE FOR RESIDUE FMN A 1312 source : AC3 5) chain A residue 20 type sequence G description BINDING SITE FOR RESIDUE FMN A 1312 source : AC3 6) chain A residue 43 type sequence K description BINDING SITE FOR RESIDUE FMN A 1312 source : AC3 7) chain A residue 44 type sequence S description BINDING SITE FOR RESIDUE FMN A 1312 source : AC3 8) chain A residue 58 type sequence Y description BINDING SITE FOR RESIDUE FMN A 1312 source : AC3 9) chain A residue 67 type sequence N description BINDING SITE FOR RESIDUE FMN A 1312 source : AC3 10) chain A residue 69 type sequence M description BINDING SITE FOR RESIDUE FMN A 1312 source : AC3 11) chain A residue 127 type sequence N description BINDING SITE FOR RESIDUE FMN A 1312 source : AC3 12) chain A residue 164 type sequence K description BINDING SITE FOR RESIDUE FMN A 1312 source : AC3 13) chain A residue 192 type sequence V description BINDING SITE FOR RESIDUE FMN A 1312 source : AC3 14) chain A residue 193 type sequence N description BINDING SITE FOR RESIDUE FMN A 1312 source : AC3 15) chain A residue 221 type sequence G description BINDING SITE FOR RESIDUE FMN A 1312 source : AC3 16) chain A residue 248 type sequence T description BINDING SITE FOR RESIDUE FMN A 1312 source : AC3 17) chain A residue 249 type sequence G description BINDING SITE FOR RESIDUE FMN A 1312 source : AC3 18) chain A residue 250 type sequence G description BINDING SITE FOR RESIDUE FMN A 1312 source : AC3 19) chain A residue 271 type sequence G description BINDING SITE FOR RESIDUE FMN A 1312 source : AC3 20) chain A residue 272 type sequence T description BINDING SITE FOR RESIDUE FMN A 1312 source : AC3 21) chain A residue 43 type sequence K description BINDING SITE FOR RESIDUE ORO A 1313 source : AC4 22) chain A residue 67 type sequence N description BINDING SITE FOR RESIDUE ORO A 1313 source : AC4 23) chain A residue 69 type sequence M description BINDING SITE FOR RESIDUE ORO A 1313 source : AC4 24) chain A residue 70 type sequence G description BINDING SITE FOR RESIDUE ORO A 1313 source : AC4 25) chain A residue 71 type sequence L description BINDING SITE FOR RESIDUE ORO A 1313 source : AC4 26) chain A residue 127 type sequence N description BINDING SITE FOR RESIDUE ORO A 1313 source : AC4 27) chain A residue 193 type sequence N description BINDING SITE FOR RESIDUE ORO A 1313 source : AC4 28) chain A residue 194 type sequence S description BINDING SITE FOR RESIDUE ORO A 1313 source : AC4 29) chain A residue 213 type sequence E description BINDING SITE FOR RESIDUE ACY A 1001 source : AC7 30) chain A residue 216 type sequence F description BINDING SITE FOR RESIDUE ACY A 1001 source : AC7 31) chain A residue 238 type sequence R description BINDING SITE FOR RESIDUE ACY B 1003 source : AC9 32) chain A residue 129 type sequence S description BINDING SITE FOR RESIDUE ACY A 1004 source : BC1 33) chain A residue 193 type sequence N description BINDING SITE FOR RESIDUE ACY A 1004 source : BC1 34) chain A residue 194 type sequence S description BINDING SITE FOR RESIDUE ACY A 1004 source : BC1 35) chain A residue 196 type sequence G description BINDING SITE FOR RESIDUE ACY A 1004 source : BC1 36) chain A residue 218 type sequence G description BINDING SITE FOR RESIDUE ACY A 1004 source : BC1 37) chain A residue 43 type catalytic sequence K description 892 source MCSA : MCSA1 38) chain A residue 130 type catalytic sequence C description 892 source MCSA : MCSA1 39) chain A residue 130 type ACT_SITE sequence C description Nucleophile source Swiss-Prot : SWS_FT_FI1 40) chain A residue 67 type BINDING sequence N description source Swiss-Prot : SWS_FT_FI3 41) chain A residue 127 type BINDING sequence N description source Swiss-Prot : SWS_FT_FI3 42) chain A residue 193 type BINDING sequence N description source Swiss-Prot : SWS_FT_FI3 43) chain A residue 43 type BINDING sequence K description source Swiss-Prot : SWS_FT_FI3 44) chain A residue 38-57 type prosite sequence GAYITKSSTLEKREGNPLPR description DHODEHASE_1 Dihydroorotate dehydrogenase signature 1. GayitKSSTlekReGNplPR source prosite : PS00911 45) chain A residue 245-265 type prosite sequence IIGTGGIETGQDAFEHLLCGA description DHODEHASE_2 Dihydroorotate dehydrogenase signature 2. IIGtGGIeTgqdAfeHLlCGA source prosite : PS00912 46) chain A residue 192 type BINDING sequence V description BINDING => ECO:0000269|PubMed:9032071, ECO:0000269|PubMed:9655329 source Swiss-Prot : SWS_FT_FI2 47) chain A residue 221 type BINDING sequence G description BINDING => ECO:0000269|PubMed:9032071, ECO:0000269|PubMed:9655329 source Swiss-Prot : SWS_FT_FI2 48) chain A residue 249 type BINDING sequence G description BINDING => ECO:0000269|PubMed:9032071, ECO:0000269|PubMed:9655329 source Swiss-Prot : SWS_FT_FI2 49) chain A residue 271 type BINDING sequence G description BINDING => ECO:0000269|PubMed:9032071, ECO:0000269|PubMed:9655329 source Swiss-Prot : SWS_FT_FI2 50) chain A residue 19 type BINDING sequence S description BINDING => ECO:0000269|PubMed:9032071, ECO:0000269|PubMed:9655329 source Swiss-Prot : SWS_FT_FI2 51) chain A residue 164 type BINDING sequence K description BINDING => ECO:0000269|PubMed:9032071, ECO:0000269|PubMed:9655329 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links