eF-site ID 1jq7-A PDB Code 1jq7 Chain A click to enlarge Title HCMV protease dimer-interface mutant, S225Y complexed to Inhibitor BILC 408 Classification HYDROLASE/HYDROLASE INHIBITOR Compound ASSEMBLIN Source null (VP40_HCMVA) Sequence A:  QSQAVAPVYVGGFLARYDQSPDEAELLLPRDVVEHWLSVA LPLNINHDDTAVVGHVAAMQSVRDGLFCLGCVTSPRFLEI VRRASEKSELVSRGPVSPLQPDKVVEFLSGSYAGLSLSSP FKHVALCSVGRRRGTLAVYGRDPEWVTQRFPDLTAADRDG LRAQWDPFRSDSYGLLGNYVDALYIRERLPKLRYDKQLVG VTERESYVKA Description Functional site 1) chain A residue 1031 type sequence E description BINDING SITE FOR RESIDUE 0FP A 261 source : AC1 2) chain A residue 1062 type sequence N description BINDING SITE FOR RESIDUE 0FP A 261 source : AC1 3) chain A residue 1063 type sequence H description BINDING SITE FOR RESIDUE 0FP A 261 source : AC1 4) chain A residue 1132 type sequence S description BINDING SITE FOR RESIDUE 0FP A 261 source : AC1 5) chain A residue 1133 type sequence L description BINDING SITE FOR RESIDUE 0FP A 261 source : AC1 6) chain A residue 1134 type sequence S description BINDING SITE FOR RESIDUE 0FP A 261 source : AC1 7) chain A residue 1135 type sequence S description BINDING SITE FOR RESIDUE 0FP A 261 source : AC1 8) chain A residue 1161 type sequence C description BINDING SITE FOR RESIDUE 0FP A 261 source : AC1 9) chain A residue 1163 type sequence V description BINDING SITE FOR RESIDUE 0FP A 261 source : AC1 10) chain A residue 1164 type sequence G description BINDING SITE FOR RESIDUE 0FP A 261 source : AC1 11) chain A residue 1165 type sequence R description BINDING SITE FOR RESIDUE 0FP A 261 source : AC1 12) chain A residue 1166 type sequence R description BINDING SITE FOR RESIDUE 0FP A 261 source : AC1 13) chain A residue 1231 type sequence I description BINDING SITE FOR RESIDUE 0FP A 261 source : AC1 14) chain A residue 1063 type catalytic sequence H description 238 source MCSA : MCSA1 15) chain A residue 1132 type catalytic sequence S description 238 source MCSA : MCSA1 16) chain A residue 1134 type catalytic sequence S description 238 source MCSA : MCSA1 17) chain A residue 1157 type catalytic sequence H description 238 source MCSA : MCSA1 18) chain A residue 1165 type catalytic sequence R description 238 source MCSA : MCSA1 19) chain A residue 1166 type catalytic sequence R description 238 source MCSA : MCSA1 20) chain A residue 1063 type ACT_SITE sequence H description Charge relay system => ECO:0000255|HAMAP-Rule:MF_04008 source Swiss-Prot : SWS_FT_FI1 21) chain A residue 1132 type ACT_SITE sequence S description Charge relay system => ECO:0000255|HAMAP-Rule:MF_04008 source Swiss-Prot : SWS_FT_FI1 22) chain A residue 1157 type ACT_SITE sequence H description Charge relay system => ECO:0000255|HAMAP-Rule:MF_04008 source Swiss-Prot : SWS_FT_FI1 23) chain A residue 1256 type SITE sequence A description Cleavage; by assemblin; Release site => ECO:0000255|HAMAP-Rule:MF_04008 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links