eF-site ID 1jlk-AB PDB Code 1jlk Chain A, B click to enlarge Title Crystal structure of the Mn(2+)-bound form of response regulator Rcp1 Classification SIGNALING PROTEIN Compound Response regulator RCP1 Source null (RCP1_SYNY3) Sequence A:  NPPKVILLVEDSKADSRLVQEVLKTSTIDHELIILRDGLA AMAFLQQQGEYENSPRPNLILLDLNLPKKDGREVLAEIKQ NPDLKRIPVVVLTTSHNEDDVIASYELHVNCYLTKSRNLK DLFKMVQGIESFWLETVTLPA B:  PKVILLVEDSKADSRLVQEVLKTSTIDHELIILRDGLAAM AFLQQQGEYENSPRPNLILLDLNLPKKDGREVLAEIKQNP DLKRIPVVVLTTSHNEDDVIASYELHVNCYLTKSRNLKDL FKMVQGIESFWLETVTLPA Description Functional site 1) chain A residue 16 type sequence D description BINDING SITE FOR RESIDUE SO4 A 624 source : AC1 2) chain A residue 68 type sequence D description BINDING SITE FOR RESIDUE SO4 A 624 source : AC1 3) chain A residue 70 type sequence N description BINDING SITE FOR RESIDUE SO4 A 624 source : AC1 4) chain A residue 99 type sequence T description BINDING SITE FOR RESIDUE SO4 A 624 source : AC1 5) chain B residue 100 type sequence S description BINDING SITE FOR RESIDUE SO4 A 624 source : AC1 6) chain B residue 101 type sequence H description BINDING SITE FOR RESIDUE SO4 A 624 source : AC1 7) chain B residue 102 type sequence N description BINDING SITE FOR RESIDUE SO4 A 624 source : AC1 8) chain A residue 91 type sequence R description BINDING SITE FOR RESIDUE SO4 A 625 source : AC2 9) chain A residue 17 type sequence S description BINDING SITE FOR RESIDUE SO4 A 626 source : AC3 10) chain A residue 18 type sequence K description BINDING SITE FOR RESIDUE SO4 A 626 source : AC3 11) chain A residue 19 type sequence A description BINDING SITE FOR RESIDUE SO4 A 626 source : AC3 12) chain B residue 101 type sequence H description BINDING SITE FOR RESIDUE SO4 A 626 source : AC3 13) chain A residue 16 type sequence D description BINDING SITE FOR RESIDUE MN A 627 source : AC4 14) chain A residue 68 type sequence D description BINDING SITE FOR RESIDUE MN A 627 source : AC4 15) chain A residue 70 type sequence N description BINDING SITE FOR RESIDUE MN A 627 source : AC4 16) chain A residue 68 type MOD_RES sequence D description 4-aspartylphosphate => ECO:0000255|PROSITE-ProRule:PRU00169, ECO:0000269|PubMed:9278513 source Swiss-Prot : SWS_FT_FI1 17) chain B residue 68 type MOD_RES sequence D description 4-aspartylphosphate => ECO:0000255|PROSITE-ProRule:PRU00169, ECO:0000269|PubMed:9278513 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links