eF-site ID 1jlk-A PDB Code 1jlk Chain A click to enlarge Title Crystal structure of the Mn(2+)-bound form of response regulator Rcp1 Classification SIGNALING PROTEIN Compound Response regulator RCP1 Source Synechocystis sp. (strain ATCC 27184 / PCC 6803 / N-1) (RCP1_SYNY3) Sequence A:  NPPKVILLVEDSKADSRLVQEVLKTSTIDHELIILRDGLA AMAFLQQQGEYENSPRPNLILLDLNLPKKDGREVLAEIKQ NPDLKRIPVVVLTTSHNEDDVIASYELHVNCYLTKSRNLK DLFKMVQGIESFWLETVTLPA Description Functional site 1) chain A residue 16 type sequence D description BINDING SITE FOR RESIDUE SO4 A 624 source : AC1 2) chain A residue 68 type sequence D description BINDING SITE FOR RESIDUE SO4 A 624 source : AC1 3) chain A residue 70 type sequence N description BINDING SITE FOR RESIDUE SO4 A 624 source : AC1 4) chain A residue 99 type sequence T description BINDING SITE FOR RESIDUE SO4 A 624 source : AC1 5) chain A residue 91 type sequence R description BINDING SITE FOR RESIDUE SO4 A 625 source : AC2 6) chain A residue 17 type sequence S description BINDING SITE FOR RESIDUE SO4 A 626 source : AC3 7) chain A residue 18 type sequence K description BINDING SITE FOR RESIDUE SO4 A 626 source : AC3 8) chain A residue 19 type sequence A description BINDING SITE FOR RESIDUE SO4 A 626 source : AC3 9) chain A residue 16 type sequence D description BINDING SITE FOR RESIDUE MN A 627 source : AC4 10) chain A residue 68 type sequence D description BINDING SITE FOR RESIDUE MN A 627 source : AC4 11) chain A residue 70 type sequence N description BINDING SITE FOR RESIDUE MN A 627 source : AC4 12) chain A residue 68 type MOD_RES sequence D description 4-aspartylphosphate => ECO:0000255|PROSITE-ProRule:PRU00169, ECO:0000269|PubMed:9278513 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links