eF-site ID 1jl3-D PDB Code 1jl3 Chain D click to enlarge Title Crystal Structure of B. subtilis ArsC Classification OXIDOREDUCTASE Compound ARSENATE REDUCTASE Source null (ARSC_BACSU) Sequence D:  KIIYFLCTGNSCRSQMAEGWAKQYLGDEWKVYSAGIEAHG LNPNAVKAMKEVGIDISNQTSDIIDSDILNNADLVVTLCG VKREHWGFDDPARAQGTEEEKWAFFQRVRDEIGNRLKEFA ETGK Description Functional site 1) chain D residue 10 type sequence C description BINDING SITE FOR RESIDUE SO4 D 1004 source : AC4 2) chain D residue 12 type sequence G description BINDING SITE FOR RESIDUE SO4 D 1004 source : AC4 3) chain D residue 13 type sequence N description BINDING SITE FOR RESIDUE SO4 D 1004 source : AC4 4) chain D residue 14 type sequence S description BINDING SITE FOR RESIDUE SO4 D 1004 source : AC4 5) chain D residue 15 type sequence C description BINDING SITE FOR RESIDUE SO4 D 1004 source : AC4 6) chain D residue 16 type sequence R description BINDING SITE FOR RESIDUE SO4 D 1004 source : AC4 7) chain D residue 17 type sequence S description BINDING SITE FOR RESIDUE SO4 D 1004 source : AC4 8) chain D residue 10 type ACT_SITE sequence C description Nucleophile => ECO:0000255|HAMAP-Rule:MF_01624, ECO:0000305|PubMed:11698660 source Swiss-Prot : SWS_FT_FI1 9) chain D residue 82 type ACT_SITE sequence C description Nucleophile => ECO:0000255|HAMAP-Rule:MF_01624, ECO:0000305|PubMed:11698660 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links