eF-site ID 1jl3-A PDB Code 1jl3 Chain A click to enlarge Title Crystal Structure of B. subtilis ArsC Classification OXIDOREDUCTASE Compound ARSENATE REDUCTASE Source Bacillus subtilis (strain 168) (ARSC_BACSU) Sequence A:  NKIIYFLCTGNSCRSQMAEGWAKQYLGDEWKVYSAGIEAH GLNPNAVKAMKEVGIDISNQTSDIIDSDILNNADLVVTLC GDAADKCPMTPPHVKREHWGFDDPARAQGTEEEKWAFFQR VRDEIGNRLKEFAETGK Description Functional site 1) chain A residue 10 type sequence C description BINDING SITE FOR RESIDUE SO4 A 1001 source : AC1 2) chain A residue 12 type sequence G description BINDING SITE FOR RESIDUE SO4 A 1001 source : AC1 3) chain A residue 13 type sequence N description BINDING SITE FOR RESIDUE SO4 A 1001 source : AC1 4) chain A residue 14 type sequence S description BINDING SITE FOR RESIDUE SO4 A 1001 source : AC1 5) chain A residue 15 type sequence C description BINDING SITE FOR RESIDUE SO4 A 1001 source : AC1 6) chain A residue 16 type sequence R description BINDING SITE FOR RESIDUE SO4 A 1001 source : AC1 7) chain A residue 17 type sequence S description BINDING SITE FOR RESIDUE SO4 A 1001 source : AC1 8) chain A residue 10 type ACT_SITE sequence C description Nucleophile => ECO:0000255|HAMAP-Rule:MF_01624, ECO:0000305|PubMed:11698660 source Swiss-Prot : SWS_FT_FI1 9) chain A residue 82 type ACT_SITE sequence C description Nucleophile => ECO:0000255|HAMAP-Rule:MF_01624, ECO:0000305|PubMed:11698660 source Swiss-Prot : SWS_FT_FI1 10) chain A residue 89 type ACT_SITE sequence C description Nucleophile => ECO:0000255|HAMAP-Rule:MF_01624, ECO:0000305|PubMed:11698660 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links