eF-site ID 1jf2-A PDB Code 1jf2 Chain A click to enlarge Title Crystal Structure of W92F obelin mutant from Obelia longissima at 1.72 Angstrom resolution Classification LUMINESCENT PROTEIN Compound obelin Source Obelia longissima (Black sea hydrozoan) (Laomedea longissima) (OBL_OBELO) Sequence A:  AVKLKTDFDNPRWIKRHKHMFDFLDINGNGKITLDEIVSK ASDDICAKLEATPEQTKRHQVCVEAFFRGCGMEYGKEIAF PQFLDGFKQLATSELKKWARNEPTLIREWGDAVFDIFDKD GSGTITLDEWKAYGKISGISPSQEDCEATFRHCDLDNSGD LDVDEMTRQHLGFWYTLDPEADGLYGNGVP Description Functional site 1) chain A residue 22 type sequence H description BINDING SITE FOR RESIDUE CZH A 196 source : AC1 2) chain A residue 25 type sequence M description BINDING SITE FOR RESIDUE CZH A 196 source : AC1 3) chain A residue 42 type sequence I description BINDING SITE FOR RESIDUE CZH A 196 source : AC1 4) chain A residue 50 type sequence I description BINDING SITE FOR RESIDUE CZH A 196 source : AC1 5) chain A residue 88 type sequence F description BINDING SITE FOR RESIDUE CZH A 196 source : AC1 6) chain A residue 92 type sequence F description BINDING SITE FOR RESIDUE CZH A 196 source : AC1 7) chain A residue 111 type sequence I description BINDING SITE FOR RESIDUE CZH A 196 source : AC1 8) chain A residue 114 type sequence W description BINDING SITE FOR RESIDUE CZH A 196 source : AC1 9) chain A residue 115 type sequence G description BINDING SITE FOR RESIDUE CZH A 196 source : AC1 10) chain A residue 138 type sequence Y description BINDING SITE FOR RESIDUE CZH A 196 source : AC1 11) chain A residue 144 type sequence I description BINDING SITE FOR RESIDUE CZH A 196 source : AC1 12) chain A residue 171 type sequence M description BINDING SITE FOR RESIDUE CZH A 196 source : AC1 13) chain A residue 175 type sequence H description BINDING SITE FOR RESIDUE CZH A 196 source : AC1 14) chain A residue 179 type sequence W description BINDING SITE FOR RESIDUE CZH A 196 source : AC1 15) chain A residue 190 type sequence Y description BINDING SITE FOR RESIDUE CZH A 196 source : AC1 16) chain A residue 22 type catalytic sequence H description 768 source MCSA : MCSA1 17) chain A residue 92 type catalytic sequence F description 768 source MCSA : MCSA1 18) chain A residue 138 type catalytic sequence Y description 768 source MCSA : MCSA1 19) chain A residue 175 type catalytic sequence H description 768 source MCSA : MCSA1 20) chain A residue 190 type catalytic sequence Y description 768 source MCSA : MCSA1 21) chain A residue 30 type BINDING sequence D description BINDING => ECO:0000255|PROSITE-ProRule:PRU00448 source Swiss-Prot : SWS_FT_FI1 22) chain A residue 134 type BINDING sequence E description BINDING => ECO:0000255|PROSITE-ProRule:PRU00448 source Swiss-Prot : SWS_FT_FI1 23) chain A residue 159 type BINDING sequence D description BINDING => ECO:0000255|PROSITE-ProRule:PRU00448 source Swiss-Prot : SWS_FT_FI1 24) chain A residue 161 type BINDING sequence D description BINDING => ECO:0000255|PROSITE-ProRule:PRU00448 source Swiss-Prot : SWS_FT_FI1 25) chain A residue 163 type BINDING sequence S description BINDING => ECO:0000255|PROSITE-ProRule:PRU00448 source Swiss-Prot : SWS_FT_FI1 26) chain A residue 165 type BINDING sequence D description BINDING => ECO:0000255|PROSITE-ProRule:PRU00448 source Swiss-Prot : SWS_FT_FI1 27) chain A residue 170 type BINDING sequence E description BINDING => ECO:0000255|PROSITE-ProRule:PRU00448 source Swiss-Prot : SWS_FT_FI1 28) chain A residue 32 type BINDING sequence N description BINDING => ECO:0000255|PROSITE-ProRule:PRU00448 source Swiss-Prot : SWS_FT_FI1 29) chain A residue 34 type BINDING sequence N description BINDING => ECO:0000255|PROSITE-ProRule:PRU00448 source Swiss-Prot : SWS_FT_FI1 30) chain A residue 36 type BINDING sequence K description BINDING => ECO:0000255|PROSITE-ProRule:PRU00448 source Swiss-Prot : SWS_FT_FI1 31) chain A residue 41 type BINDING sequence E description BINDING => ECO:0000255|PROSITE-ProRule:PRU00448 source Swiss-Prot : SWS_FT_FI1 32) chain A residue 123 type BINDING sequence D description BINDING => ECO:0000255|PROSITE-ProRule:PRU00448 source Swiss-Prot : SWS_FT_FI1 33) chain A residue 125 type BINDING sequence D description BINDING => ECO:0000255|PROSITE-ProRule:PRU00448 source Swiss-Prot : SWS_FT_FI1 34) chain A residue 127 type BINDING sequence S description BINDING => ECO:0000255|PROSITE-ProRule:PRU00448 source Swiss-Prot : SWS_FT_FI1 35) chain A residue 129 type BINDING sequence T description BINDING => ECO:0000255|PROSITE-ProRule:PRU00448 source Swiss-Prot : SWS_FT_FI1 36) chain A residue 30-42 type prosite sequence DINGNGKITLDEI description EF_HAND_1 EF-hand calcium-binding domain. DINGNGKITldEI source prosite : PS00018 37) chain A residue 123-135 type prosite sequence DKDGSGTITLDEW description EF_HAND_1 EF-hand calcium-binding domain. DINGNGKITldEI source prosite : PS00018 38) chain A residue 159-171 type prosite sequence DLDNSGDLDVDEM description EF_HAND_1 EF-hand calcium-binding domain. DINGNGKITldEI source prosite : PS00018

Display surface Download Links