eF-site ID 1j5c_31-A PDB Code 1j5c Model 31 Chain A click to enlarge Title SOLUTION STRUCTURE OF OXIDIZED PARAMAGNETIC CU(II) PLASTOCYANIN FROM SYNECHOCYSTIS PCC6803 Classification ELECTRON TRANSPORT Compound PLASTOCYANIN Source null (PLAS_SYNY3) Sequence A:  ANATVKMGSDSGALVFEPSTVTIKAGEEVKWVNNKLSPHN IVFAADGVDADTAAKLSHKGLAFAAGESFTSTFTEPGTYT YYCEPHRGAGMVGKVVVD Description Functional site 1) chain A residue 16 type sequence F description BINDING SITE FOR RESIDUE CU A 99 source : AC1 2) chain A residue 39 type sequence H description BINDING SITE FOR RESIDUE CU A 99 source : AC1 3) chain A residue 83 type sequence C description BINDING SITE FOR RESIDUE CU A 99 source : AC1 4) chain A residue 86 type sequence H description BINDING SITE FOR RESIDUE CU A 99 source : AC1 5) chain A residue 91 type sequence M description BINDING SITE FOR RESIDUE CU A 99 source : AC1 6) chain A residue 86 type BINDING sequence H description BINDING => ECO:0000269|PubMed:9466912 source Swiss-Prot : SWS_FT_FI1 7) chain A residue 91 type BINDING sequence M description BINDING => ECO:0000269|PubMed:9466912 source Swiss-Prot : SWS_FT_FI1 8) chain A residue 39 type BINDING sequence H description BINDING => ECO:0000269|PubMed:9466912 source Swiss-Prot : SWS_FT_FI1 9) chain A residue 83 type BINDING sequence C description BINDING => ECO:0000269|PubMed:9466912 source Swiss-Prot : SWS_FT_FI1 10) chain A residue 77-91 type prosite sequence GTYTYYCEPHRGAGM description COPPER_BLUE Type-1 copper (blue) proteins signature. Gt.YtYYCe.P.HrgagM source prosite : PS00196

Display surface Download Links