eF-site ID 1j04-A PDB Code 1j04 Chain A click to enlarge Title Structural mechanism of enzyme mistargeting in hereditary kidney stone disease in vitro Classification TRANSFERASE Compound alanine--glyoxylate aminotransferase Source (SPYA_HUMAN) Sequence A:  HKLLVTPPKALLKPLSIPNQLLLGPGPSNLPPRIMAAGGL QMIGSMSKDMYQIMDEIKEGIQYVFQTRNPLTLVISGSGH CALEAALVNVLEPGDSFLVGANGIWGQRAVDIGERIGARV HPMTKDPGGHYTLQEVEEGLAQHKPVLLFLTHGESSTGVL QPLDGFRELCHRYKCLLLVDSVASLGGTPLYMDRQGIDIL YSGSQXALNAPPGTSLISFSDKAKKKMYSRKTKPFSFYLD IKWLANFWGCDDQPRMYHHTIPVISLYSLRESLALIAEQG LENSWRQHREAAAYLHGRLQALGLQLFVKDPALRLPTVTT VAVPAGYDWRDIVSYVIDHFDIEIMGGLGPSTGKVLRIGL LGCNATRENVDRVTEALRAALQHCPKK Description Functional site 1) chain A residue 28 type sequence P description BINDING SITE FOR RESIDUE AOA A 1001 source : AC1 2) chain A residue 29 type sequence G description BINDING SITE FOR RESIDUE AOA A 1001 source : AC1 3) chain A residue 209 type sequence X description BINDING SITE FOR RESIDUE AOA A 1001 source : AC1 4) chain A residue 348 type sequence M description BINDING SITE FOR RESIDUE AOA A 1001 source : AC1 5) chain A residue 360 type sequence R description BINDING SITE FOR RESIDUE AOA A 1001 source : AC1 6) chain A residue 24 type sequence L description BINDING SITE FOR RESIDUE GOL A 1002 source : AC2 7) chain A residue 71 type sequence R description BINDING SITE FOR RESIDUE GOL A 1002 source : AC2 8) chain A residue 196 type sequence D description BINDING SITE FOR RESIDUE GOL A 1002 source : AC2 9) chain A residue 343 type sequence F description BINDING SITE FOR RESIDUE GOL A 1002 source : AC2 10) chain A residue 228 type sequence K description BINDING SITE FOR RESIDUE GOL A 1003 source : AC3 11) chain A residue 290 type sequence Q description BINDING SITE FOR RESIDUE GOL A 1003 source : AC3 12) chain A residue 370 type sequence R description BINDING SITE FOR RESIDUE GOL A 1003 source : AC3 13) chain A residue 371 type sequence E description BINDING SITE FOR RESIDUE GOL A 1003 source : AC3 14) chain A residue 19 type sequence S description BINDING SITE FOR RESIDUE GOL A 1004 source : AC4 15) chain A residue 52 type sequence D description BINDING SITE FOR RESIDUE GOL A 1004 source : AC4 16) chain A residue 55 type sequence Q description BINDING SITE FOR RESIDUE GOL A 1004 source : AC4 17) chain A residue 59 type sequence E description BINDING SITE FOR RESIDUE GOL A 1004 source : AC4 18) chain A residue 110 type sequence Q description BINDING SITE FOR RESIDUE GOL A 1006 source : AC5 19) chain A residue 111 type sequence R description BINDING SITE FOR RESIDUE GOL A 1006 source : AC5 20) chain A residue 246 type sequence W description BINDING SITE FOR RESIDUE GOL A 1006 source : AC5 21) chain A residue 278 type sequence L description BINDING SITE FOR RESIDUE GOL A 1007 source : AC6 22) chain A residue 7 type sequence L description BINDING SITE FOR RESIDUE GOL A 1008 source : AC7 23) chain A residue 22 type sequence N description BINDING SITE FOR RESIDUE GOL A 1008 source : AC7 24) chain A residue 170 type sequence R description BINDING SITE FOR RESIDUE GOL A 1008 source : AC7 25) chain A residue 196 type sequence D description BINDING SITE FOR RESIDUE GOL A 1008 source : AC7 26) chain A residue 137 type sequence Q description BINDING SITE FOR RESIDUE GOL A 1009 source : AC8 27) chain A residue 138 type sequence E description BINDING SITE FOR RESIDUE GOL A 1009 source : AC8 28) chain A residue 141 type sequence E description BINDING SITE FOR RESIDUE GOL A 1009 source : AC8 29) chain A residue 225 type MOD_RES sequence K description N6-succinyllysine; alternate => ECO:0000250|UniProtKB:O35423 source Swiss-Prot : SWS_FT_FI4 30) chain A residue 234 type MOD_RES sequence K description N6-acetyllysine => ECO:0000250|UniProtKB:O35423 source Swiss-Prot : SWS_FT_FI5 31) chain A residue 312 type MOD_RES sequence K description N6-acetyllysine => ECO:0000250|UniProtKB:O35423 source Swiss-Prot : SWS_FT_FI5 32) chain A residue 200-220 type prosite sequence IDILYSGSQXALNAPPGTSLI description AA_TRANSFER_CLASS_5 Aminotransferases class-V pyridoxal-phosphate attachment site. IDILysGSQKalnappGtSlI source prosite : PS00595 33) chain A residue 209 type MOD_RES sequence X description N6-(pyridoxal phosphate)lysine source Swiss-Prot : SWS_FT_FI3 34) chain A residue 360 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI1 35) chain A residue 9 type MOD_RES sequence T description Phosphothreonine => ECO:0007744|PubMed:24275569 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links