eF-site ID 1iy1-A PDB Code 1iy1 Chain A click to enlarge Title Crystal structure of the FtsH ATPase domain with ADP from Thermus thermophilus Classification HYDROLASE Compound ATP-dependent metalloprotease FtsH Source (Q9LCZ4_THETH) Sequence A:  KVTFKDVAGAEEAKEELKEIVEFLKNPSRFHEMGARIPKG VLLVGPPGVGKTHLARAVAGEARVPFITASGSDFVEMFVG VGAARVRDLFETAKRHAPCIVFIDEIDAVGRNDEREQTLN QLLVEMDGFEKDTAIVVMAATNRPDILDPALLRPGRFDRQ IAIDAPDVKGREQILRIHARGKPLAEDVDLALLAKRTPGF VGADLENLLNEAALLAAREGRRKITMKDLEEAAS Description Functional site 1) chain A residue 157 type sequence D description BINDING SITE FOR RESIDUE ADP A 1 source : AC1 2) chain A residue 159 type sequence A description BINDING SITE FOR RESIDUE ADP A 1 source : AC1 3) chain A residue 197 type sequence P description BINDING SITE FOR RESIDUE ADP A 1 source : AC1 4) chain A residue 198 type sequence P description BINDING SITE FOR RESIDUE ADP A 1 source : AC1 5) chain A residue 199 type sequence G description BINDING SITE FOR RESIDUE ADP A 1 source : AC1 6) chain A residue 200 type sequence V description BINDING SITE FOR RESIDUE ADP A 1 source : AC1 7) chain A residue 201 type sequence G description BINDING SITE FOR RESIDUE ADP A 1 source : AC1 8) chain A residue 202 type sequence K description BINDING SITE FOR RESIDUE ADP A 1 source : AC1 9) chain A residue 203 type sequence T description BINDING SITE FOR RESIDUE ADP A 1 source : AC1 10) chain A residue 204 type sequence H description BINDING SITE FOR RESIDUE ADP A 1 source : AC1 11) chain A residue 333 type sequence Q description BINDING SITE FOR RESIDUE ADP A 1 source : AC1 12) chain A residue 334 type sequence I description BINDING SITE FOR RESIDUE ADP A 1 source : AC1 13) chain A residue 337 type sequence I description BINDING SITE FOR RESIDUE ADP A 1 source : AC1 14) chain A residue 295-313 type prosite sequence IVVMAATNRPDILDPALLR description AAA AAA-protein family signature. IvVMaATNrpdiLDpALl.R source prosite : PS00674 15) chain A residue 159 type BINDING sequence A description source Swiss-Prot : SWS_FT_FI1 16) chain A residue 199 type BINDING sequence G description source Swiss-Prot : SWS_FT_FI1 17) chain A residue 204 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI1

Display surface Download Links