eF-site ID 1ioc-A PDB Code 1ioc Chain A click to enlarge Title CRYSTAL STRUCTURE OF MUTANT HUMAN LYSOZYME, EAEA-I56T Classification HYDROLASE Compound LYSOZYME C Source (LYSC_HUMAN) Sequence A:  AEAKVFERCELARTLKRLGMDGYRGISLANWMCLAKWESG YNTRATNYNAGDRSTDYGTFQINSRYWCNDGKTPGAVNAC HLSCSALLQDNIADAVACAKRVVRDPQGIRAWVAWRNRCQ NRDVRQYVQGCGV Description Functional site 1) chain A residue 4 type sequence E description BINDING SITE FOR RESIDUE NA A 901 source : AC1 2) chain A residue 66 type sequence N description BINDING SITE FOR RESIDUE NA A 901 source : AC1 3) chain A residue 79 type sequence L description BINDING SITE FOR RESIDUE NA A 901 source : AC1 4) chain A residue 80 type sequence S description BINDING SITE FOR RESIDUE NA A 901 source : AC1 5) chain A residue 88 type sequence N description BINDING SITE FOR RESIDUE NA A 901 source : AC1 6) chain A residue 7 type sequence E description BINDING SITE FOR RESIDUE NA A 902 source : AC2 7) chain A residue 7 type sequence E description BINDING SITE FOR RESIDUE NA A 902 source : AC2 8) chain A residue 4 type sequence E description BINDING SITE FOR RESIDUE NA A 903 source : AC3 9) chain A residue 77-95 type prosite sequence CHLSCSALLQDNIADAVAC description GLYCOSYL_HYDROL_F22_1 Glycosyl hydrolases family 22 (GH22) domain signature. ChlsCsaLlqdNIadavaC source prosite : PS00128 10) chain A residue 35 type ACT_SITE sequence E description source Swiss-Prot : SWS_FT_FI1 11) chain A residue 53 type ACT_SITE sequence D description source Swiss-Prot : SWS_FT_FI1

Display surface Download Links