eF-site ID 1iin-A
PDB Code 1iin
Chain A

click to enlarge
Title thymidylyltransferase complexed with UDP-glucose
Classification TRANSFERASE
Compound glucose-1-phosphate thymidylyltransferase
Source Salmonella choleraesuis (Q9F7K6_9ENTR)
Sequence A:  MKTRKGIILAGGSGTRLYPVTMAVSQQLLPIYDKPMIYYP
LSTLMLAGIRDILIISTPQDTPRFQQLLGDGSQWGLNLQY
KVQPSPDGLAQAFIIGEEFIGHDDCALVLGDNIFYGHDLP
KLMEAAVNKESGATVFAYHVNDPERYGVVEFDQKGTAVSL
EEKPLQPKSNYAVTGLYFYDNSVVEMAKNLKPSARGELEI
TDINRIYMEQGRLSVAMMGRGYAWLDTGTHQSLIEASNFI
ATIEERQGLKVSCPEEIAFRKNFINAQQVIELAGPLSKND
YGKYLLKMV
Description (1)  glucose-1-phosphate thymidylyltransferase (E.C.2.7.7.24)


Functional site

1) chain A
residue 9
type
ligand
sequence L
description BINDING SITE FOR RESIDUE UPG A 1501
source : AC1

2) chain A
residue 11
type
ligand
sequence G
description BINDING SITE FOR RESIDUE UPG A 1501
source : AC1

3) chain A
residue 12
type
ligand
sequence G
description BINDING SITE FOR RESIDUE UPG A 1501
source : AC1

4) chain A
residue 16
type
ligand
sequence R
description BINDING SITE FOR RESIDUE UPG A 1501
source : AC1

5) chain A
residue 27
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE UPG A 1501
source : AC1

6) chain A
residue 83
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE UPG A 1501
source : AC1

7) chain A
residue 86
type
ligand
sequence P
description BINDING SITE FOR RESIDUE UPG A 1501
source : AC1

8) chain A
residue 87
type
ligand
sequence D
description BINDING SITE FOR RESIDUE UPG A 1501
source : AC1

9) chain A
residue 88
type
ligand
sequence G
description BINDING SITE FOR RESIDUE UPG A 1501
source : AC1

10) chain A
residue 109
type
ligand
sequence L
description BINDING SITE FOR RESIDUE UPG A 1501
source : AC1

11) chain A
residue 111
type
ligand
sequence D
description BINDING SITE FOR RESIDUE UPG A 1501
source : AC1

12) chain A
residue 112
type
ligand
sequence N
description BINDING SITE FOR RESIDUE UPG A 1501
source : AC1

13) chain A
residue 146
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE UPG A 1501
source : AC1

14) chain A
residue 147
type
ligand
sequence G
description BINDING SITE FOR RESIDUE UPG A 1501
source : AC1

15) chain A
residue 162
type
ligand
sequence E
description BINDING SITE FOR RESIDUE UPG A 1501
source : AC1

16) chain A
residue 163
type
ligand
sequence K
description BINDING SITE FOR RESIDUE UPG A 1501
source : AC1

17) chain A
residue 173
type
ligand
sequence V
description BINDING SITE FOR RESIDUE UPG A 1501
source : AC1

18) chain A
residue 195
type
ligand
sequence R
description BINDING SITE FOR RESIDUE UPG A 1501
source : AC1

19) chain A
residue 201
type
ligand
sequence T
description BINDING SITE FOR RESIDUE UPG A 1501
source : AC1

20) chain A
residue 224
type
ligand
sequence W
description BINDING SITE FOR RESIDUE UPG A 1501
source : AC1

21) chain A
residue 9-13
type binding
ligand UPG: URIDINE-5'-DIPHOSPHATE-GLUCOSE
sequence LAGGS
description URIDINE-5'-DIPHOSPHATE-GLUCOSE binding site
source pdb_hetatom : UPG_1iin_A_1501

22) chain A
residue 16
type binding
ligand UPG: URIDINE-5'-DIPHOSPHATE-GLUCOSE
sequence R
description URIDINE-5'-DIPHOSPHATE-GLUCOSE binding site
source pdb_hetatom : UPG_1iin_A_1501

23) chain A
residue 26-27
type binding
ligand UPG: URIDINE-5'-DIPHOSPHATE-GLUCOSE
sequence QQ
description URIDINE-5'-DIPHOSPHATE-GLUCOSE binding site
source pdb_hetatom : UPG_1iin_A_1501

24) chain A
residue 83
type binding
ligand UPG: URIDINE-5'-DIPHOSPHATE-GLUCOSE
sequence Q
description URIDINE-5'-DIPHOSPHATE-GLUCOSE binding site
source pdb_hetatom : UPG_1iin_A_1501

25) chain A
residue 85-89
type binding
ligand UPG: URIDINE-5'-DIPHOSPHATE-GLUCOSE
sequence SPDGL
description URIDINE-5'-DIPHOSPHATE-GLUCOSE binding site
source pdb_hetatom : UPG_1iin_A_1501

26) chain A
residue 109
type binding
ligand UPG: URIDINE-5'-DIPHOSPHATE-GLUCOSE
sequence L
description URIDINE-5'-DIPHOSPHATE-GLUCOSE binding site
source pdb_hetatom : UPG_1iin_A_1501

27) chain A
residue 111-112
type binding
ligand UPG: URIDINE-5'-DIPHOSPHATE-GLUCOSE
sequence DN
description URIDINE-5'-DIPHOSPHATE-GLUCOSE binding site
source pdb_hetatom : UPG_1iin_A_1501

28) chain A
residue 145-147
type binding
ligand UPG: URIDINE-5'-DIPHOSPHATE-GLUCOSE
sequence RYG
description URIDINE-5'-DIPHOSPHATE-GLUCOSE binding site
source pdb_hetatom : UPG_1iin_A_1501

29) chain A
residue 162-163
type binding
ligand UPG: URIDINE-5'-DIPHOSPHATE-GLUCOSE
sequence EK
description URIDINE-5'-DIPHOSPHATE-GLUCOSE binding site
source pdb_hetatom : UPG_1iin_A_1501

30) chain A
residue 173-175
type binding
ligand UPG: URIDINE-5'-DIPHOSPHATE-GLUCOSE
sequence VTG
description URIDINE-5'-DIPHOSPHATE-GLUCOSE binding site
source pdb_hetatom : UPG_1iin_A_1501

31) chain A
residue 177
type binding
ligand UPG: URIDINE-5'-DIPHOSPHATE-GLUCOSE
sequence Y
description URIDINE-5'-DIPHOSPHATE-GLUCOSE binding site
source pdb_hetatom : UPG_1iin_A_1501

32) chain A
residue 195
type binding
ligand UPG: URIDINE-5'-DIPHOSPHATE-GLUCOSE
sequence R
description URIDINE-5'-DIPHOSPHATE-GLUCOSE binding site
source pdb_hetatom : UPG_1iin_A_1501

33) chain A
residue 197
type binding
ligand UPG: URIDINE-5'-DIPHOSPHATE-GLUCOSE
sequence E
description URIDINE-5'-DIPHOSPHATE-GLUCOSE binding site
source pdb_hetatom : UPG_1iin_A_1501

34) chain A
residue 199-201
type binding
ligand UPG: URIDINE-5'-DIPHOSPHATE-GLUCOSE
sequence EIT
description URIDINE-5'-DIPHOSPHATE-GLUCOSE binding site
source pdb_hetatom : UPG_1iin_A_1501

35) chain A
residue 224
type binding
ligand UPG: URIDINE-5'-DIPHOSPHATE-GLUCOSE
sequence W
description URIDINE-5'-DIPHOSPHATE-GLUCOSE binding site
source pdb_hetatom : UPG_1iin_A_1501

36) chain A
residue 16
type catalytic
ligand
sequence R
description Annotated By Reference To The Literature 1hv9
source CSA : CSA1


Display surface

Download
Links