eF-site ID 1igt-D
PDB Code 1igt
Chain D

click to enlarge
Title STRUCTURE OF IMMUNOGLOBULIN
Classification IMMUNOGLOBULIN
Compound IGG2A INTACT ANTIBODY - MAB231
Source ORGANISM_COMMON: house mouse; ORGANISM_SCIENTIFIC: Mus musculus;
Sequence D:  EVKLQESGGGLVQPGGSLKLSCATSGFTFSDYYMYWVRQT
PEKRLEWVAYISNGGGSTYYPDTVKGRFTISRDNAKNTLY
LQMSRLKSEDTAMYYCARHGGYYAMDYWGQGTTVTVSSAK
TTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWN
SGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITC
NVAHPASSTKVDKKIEPRGPTIKPCPPCKCPAPNLLGGPS
VFIFPPKIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFV
NNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEF
KCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMT
KKQVTLTCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLD
SDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTK
SFSR
Description (1)  IGG2A INTACT ANTIBODY - MAB231


Functional site

1) chain D
residue 313
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE NAG D 475
source : BC1

2) chain D
residue 314
type
ligand
sequence N
description BINDING SITE FOR RESIDUE NAG D 475
source : BC1

3) chain D
residue 313
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE FUC D 476
source : BC2

4) chain D
residue 256
type
ligand
sequence F
description BINDING SITE FOR RESIDUE BMA D 478
source : BC4

5) chain D
residue 259
type
ligand
sequence K
description BINDING SITE FOR RESIDUE NAG D 480
source : BC6

6) chain D
residue 262
type
ligand
sequence D
description BINDING SITE FOR RESIDUE GAL D 481
source : BC7

7) chain D
residue 271
type
ligand
sequence I
description BINDING SITE FOR RESIDUE GAL D 481
source : BC7

8) chain D
residue 273
type
ligand
sequence T
description BINDING SITE FOR RESIDUE GAL D 481
source : BC7

9) chain D
residue 353
type
ligand
sequence R
description BINDING SITE FOR RESIDUE NAG D 483
source : BC9

10) chain D
residue 454-460
type prosite
ligand
sequence YSCSVVH
description Immunoglobulins and major histocompatibility complex proteins signature. [FY]-{L}-C-{PGAD}-[VA]-{LC}-H
source prosite : PS00290

11) chain D
residue 253-254
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence VF
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_1igt_D_483

12) chain D
residue 353
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence R
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_1igt_D_483

13) chain D
residue 254
type binding
ligand BMA: BETA-D-MANNOSE
sequence F
description BETA-D-MANNOSE binding site
source pdb_hetatom : BMA_1igt_D_478

14) chain D
residue 256
type binding
ligand BMA: BETA-D-MANNOSE
sequence F
description BETA-D-MANNOSE binding site
source pdb_hetatom : BMA_1igt_D_478

15) chain D
residue 254
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence F
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_1igt_D_477

16) chain D
residue 277
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence V
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_1igt_D_477

17) chain D
residue 313
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence Y
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_1igt_D_477

18) chain D
residue 320
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence R
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_1igt_D_477

19) chain D
residue 254
type binding
ligand MAN: ALPHA-D-MANNOSE
sequence F
description ALPHA-D-MANNOSE binding site
source pdb_hetatom : MAN_1igt_D_482

20) chain D
residue 353
type binding
ligand MAN: ALPHA-D-MANNOSE
sequence R
description ALPHA-D-MANNOSE binding site
source pdb_hetatom : MAN_1igt_D_482

21) chain D
residue 256-259
type binding
ligand GAL: BETA-D-GALACTOSE
sequence FPPK
description BETA-D-GALACTOSE binding site
source pdb_hetatom : GAL_1igt_D_481

22) chain D
residue 262
type binding
ligand GAL: BETA-D-GALACTOSE
sequence D
description BETA-D-GALACTOSE binding site
source pdb_hetatom : GAL_1igt_D_481

23) chain D
residue 269
type binding
ligand GAL: BETA-D-GALACTOSE
sequence S
description BETA-D-GALACTOSE binding site
source pdb_hetatom : GAL_1igt_D_481

24) chain D
residue 271-273
type binding
ligand GAL: BETA-D-GALACTOSE
sequence IVT
description BETA-D-GALACTOSE binding site
source pdb_hetatom : GAL_1igt_D_481

25) chain D
residue 324
type binding
ligand GAL: BETA-D-GALACTOSE
sequence A
description BETA-D-GALACTOSE binding site
source pdb_hetatom : GAL_1igt_D_481

26) chain D
residue 256
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence F
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_1igt_D_480

27) chain D
residue 259
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence K
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_1igt_D_480

28) chain D
residue 273
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence T
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_1igt_D_480

29) chain D
residue 275
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence V
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_1igt_D_480

30) chain D
residue 320
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence R
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_1igt_D_480

31) chain D
residue 322
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence V
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_1igt_D_480

32) chain D
residue 256
type binding
ligand MAN: ALPHA-D-MANNOSE
sequence F
description ALPHA-D-MANNOSE binding site
source pdb_hetatom : MAN_1igt_D_479

33) chain D
residue 320
type binding
ligand MAN: ALPHA-D-MANNOSE
sequence R
description ALPHA-D-MANNOSE binding site
source pdb_hetatom : MAN_1igt_D_479

34) chain D
residue 278
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence D
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_1igt_D_475

35) chain D
residue 313-314
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence YN
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_1igt_D_475

36) chain D
residue 318
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence T
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_1igt_D_475

37) chain D
residue 313
type binding
ligand FUC: ALPHA-L-FUCOSE
sequence Y
description ALPHA-L-FUCOSE binding site
source pdb_hetatom : FUC_1igt_D_476


Display surface

Download
Links