eF-site ID 1igt-C
PDB Code 1igt
Chain C

click to enlarge
Title STRUCTURE OF IMMUNOGLOBULIN
Classification IMMUNOGLOBULIN
Compound IGG2A INTACT ANTIBODY - MAB231
Source ORGANISM_COMMON: house mouse; ORGANISM_SCIENTIFIC: Mus musculus;
Sequence C:  DIVLTQSPSSLSASLGDTITITCHASQNINVWLSWYQQKP
GNIPKLLIYKASNLHTGVPSRFSGSGSGTGFTLTISSLQP
EDIATYYCQQGQSYPLTFGGGTKLEIKRADAAPTVSIFPP
SSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVL
NSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKT
STSPIVKSFNRNEC
Description (1)  IGG2A INTACT ANTIBODY - MAB231

Display surface

Download
Links