eF-site ID 1igt-B
PDB Code 1igt
Chain B

click to enlarge
Title STRUCTURE OF IMMUNOGLOBULIN
Classification IMMUNOGLOBULIN
Compound IGG2A INTACT ANTIBODY - MAB231
Source ORGANISM_COMMON: house mouse; ORGANISM_SCIENTIFIC: Mus musculus;
Sequence B:  EVKLQESGGGLVQPGGSLKLSCATSGFTFSDYYMYWVRQT
PEKRLEWVAYISNGGGSTYYPDTVKGRFTISRDNAKNTLY
LQMSRLKSEDTAMYYCARHGGYYAMDYWGQGTTVTVSSAK
TTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWN
SGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITC
NVAHPASSTKVDKKIEPRGPTIKPCPPCKCPAPNLLGGPS
VFIFPPKIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFV
NNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEF
KCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMT
KKQVTLTCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLD
SDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTK
SFSR
Description (1)  IGG2A INTACT ANTIBODY - MAB231


Functional site

1) chain B
residue 278
type
ligand
sequence D
description BINDING SITE FOR RESIDUE NAG B 475
source : AC1

2) chain B
residue 313
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE NAG B 475
source : AC1

3) chain B
residue 314
type
ligand
sequence N
description BINDING SITE FOR RESIDUE NAG B 475
source : AC1

4) chain B
residue 313
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE FUL B 476
source : AC2

5) chain B
residue 254
type
ligand
sequence F
description BINDING SITE FOR RESIDUE BMA B 478
source : AC4

6) chain B
residue 259
type
ligand
sequence K
description BINDING SITE FOR RESIDUE NAG B 480
source : AC6

7) chain B
residue 273
type
ligand
sequence T
description BINDING SITE FOR RESIDUE NAG B 480
source : AC6

8) chain B
residue 275
type
ligand
sequence V
description BINDING SITE FOR RESIDUE NAG B 480
source : AC6

9) chain B
residue 257
type
ligand
sequence P
description BINDING SITE FOR RESIDUE GAL B 481
source : AC7

10) chain B
residue 259
type
ligand
sequence K
description BINDING SITE FOR RESIDUE GAL B 481
source : AC7

11) chain B
residue 262
type
ligand
sequence D
description BINDING SITE FOR RESIDUE GAL B 481
source : AC7

12) chain B
residue 271
type
ligand
sequence I
description BINDING SITE FOR RESIDUE GAL B 481
source : AC7

13) chain B
residue 273
type
ligand
sequence T
description BINDING SITE FOR RESIDUE GAL B 481
source : AC7

14) chain B
residue 353
type
ligand
sequence R
description BINDING SITE FOR RESIDUE NAG B 483
source : AC9

15) chain B
residue 454-460
type prosite
ligand
sequence YSCSVVH
description Immunoglobulins and major histocompatibility complex proteins signature. [FY]-{L}-C-{PGAD}-[VA]-{LC}-H
source prosite : PS00290

16) chain B
residue 248
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence L
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_1igt_B_475

17) chain B
residue 277-278
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence VD
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_1igt_B_475

18) chain B
residue 313-318
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence YNST
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_1igt_B_475

19) chain B
residue 320
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence R
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_1igt_B_475

20) chain B
residue 252
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence S
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_1igt_B_477

21) chain B
residue 254
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence F
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_1igt_B_477

22) chain B
residue 275
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence V
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_1igt_B_477

23) chain B
residue 277-278
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence VD
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_1igt_B_477

24) chain B
residue 313
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence Y
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_1igt_B_477

25) chain B
residue 320
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence R
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_1igt_B_477

26) chain B
residue 253-255
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence VFI
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_1igt_B_483

27) chain B
residue 353
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence R
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_1igt_B_483

28) chain B
residue 254
type binding
ligand BMA: BETA-D-MANNOSE
sequence F
description BETA-D-MANNOSE binding site
source pdb_hetatom : BMA_1igt_B_478

29) chain B
residue 256
type binding
ligand BMA: BETA-D-MANNOSE
sequence F
description BETA-D-MANNOSE binding site
source pdb_hetatom : BMA_1igt_B_478

30) chain B
residue 254
type binding
ligand MAN: ALPHA-D-MANNOSE
sequence F
description ALPHA-D-MANNOSE binding site
source pdb_hetatom : MAN_1igt_B_482

31) chain B
residue 256-257
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence FP
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_1igt_B_480

32) chain B
residue 259
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence K
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_1igt_B_480

33) chain B
residue 273
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence T
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_1igt_B_480

34) chain B
residue 275
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence V
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_1igt_B_480

35) chain B
residue 322
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence V
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_1igt_B_480

36) chain B
residue 256-259
type binding
ligand GAL: BETA-D-GALACTOSE
sequence FPPK
description BETA-D-GALACTOSE binding site
source pdb_hetatom : GAL_1igt_B_481

37) chain B
residue 262
type binding
ligand GAL: BETA-D-GALACTOSE
sequence D
description BETA-D-GALACTOSE binding site
source pdb_hetatom : GAL_1igt_B_481

38) chain B
residue 269-273
type binding
ligand GAL: BETA-D-GALACTOSE
sequence SPIVT
description BETA-D-GALACTOSE binding site
source pdb_hetatom : GAL_1igt_B_481

39) chain B
residue 256
type binding
ligand MAN: ALPHA-D-MANNOSE
sequence F
description ALPHA-D-MANNOSE binding site
source pdb_hetatom : MAN_1igt_B_479

40) chain B
residue 275
type binding
ligand MAN: ALPHA-D-MANNOSE
sequence V
description ALPHA-D-MANNOSE binding site
source pdb_hetatom : MAN_1igt_B_479

41) chain B
residue 320
type binding
ligand MAN: ALPHA-D-MANNOSE
sequence R
description ALPHA-D-MANNOSE binding site
source pdb_hetatom : MAN_1igt_B_479

42) chain B
residue 313
type binding
ligand FUL: BETA-L-FUCOSE
sequence Y
description BETA-L-FUCOSE binding site
source pdb_hetatom : FUL_1igt_B_476


Display surface

Download
Links