eF-site ID 1ic6-A PDB Code 1ic6 Chain A click to enlarge Title STRUCTURE OF A SERINE PROTEASE PROTEINASE K FROM TRITIRACHIUM ALBUM LIMBER AT 0.98 A RESOLUTION Classification HYDROLASE Compound PROTEINASE K Source ORGANISM_SCIENTIFIC: Engyodontium album; Sequence A:  AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDT GIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSR TYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNN RNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAG NNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLD IFGPGTDILSTWIGGSTRSISGTSMATPHVAGLAAYLMTL GKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA Description (1)  PROTEINASE K (E.C.3.4.21.64) Functional site 1) chain A residue 175 type sequence P description BINDING SITE FOR RESIDUE CA A 280 source : AC1 2) chain A residue 177 type sequence V description BINDING SITE FOR RESIDUE CA A 280 source : AC1 3) chain A residue 200 type sequence D description BINDING SITE FOR RESIDUE CA A 280 source : AC1 4) chain A residue 16 type sequence T description BINDING SITE FOR RESIDUE CA A 281 source : AC2 5) chain A residue 260 type sequence D description BINDING SITE FOR RESIDUE CA A 281 source : AC2 6) chain A residue 60 type sequence Y description BINDING SITE FOR RESIDUE NO3 A 901 source : AC3 7) chain A residue 61 type sequence Y description BINDING SITE FOR RESIDUE NO3 A 901 source : AC3 8) chain A residue 80 type sequence R description BINDING SITE FOR RESIDUE NO3 A 901 source : AC3 9) chain A residue 94 type sequence K description BINDING SITE FOR RESIDUE NO3 A 901 source : AC3 10) chain A residue 97 type sequence D description BINDING SITE FOR RESIDUE NO3 A 901 source : AC3 11) chain A residue 98 type sequence D description BINDING SITE FOR RESIDUE NO3 A 901 source : AC3 12) chain A residue 158 type sequence A description BINDING SITE FOR RESIDUE NO3 A 902 source : AC4 13) chain A residue 160 type sequence G description BINDING SITE FOR RESIDUE NO3 A 902 source : AC4 14) chain A residue 161 type sequence N description BINDING SITE FOR RESIDUE NO3 A 902 source : AC4 15) chain A residue 223 type sequence T description BINDING SITE FOR RESIDUE NO3 A 902 source : AC4 16) chain A residue 224 type sequence S description BINDING SITE FOR RESIDUE NO3 A 902 source : AC4 17) chain A residue 102 type sequence G description BINDING SITE FOR RESIDUE NO3 A 903 source : AC5 18) chain A residue 104 type sequence Y description BINDING SITE FOR RESIDUE NO3 A 903 source : AC5 19) chain A residue 107 type sequence I description BINDING SITE FOR RESIDUE NO3 A 903 source : AC5 20) chain A residue 133 type sequence L description BINDING SITE FOR RESIDUE NO3 A 903 source : AC5 21) chain A residue 134 type sequence G description BINDING SITE FOR RESIDUE NO3 A 903 source : AC5 22) chain A residue 64 type sequence R description BINDING SITE FOR RESIDUE NO3 A 904 source : AC6 23) chain A residue 165 type sequence D description BINDING SITE FOR RESIDUE NO3 A 904 source : AC6 24) chain A residue 167 type sequence R description BINDING SITE FOR RESIDUE NO3 A 904 source : AC6 25) chain A residue 168 type sequence N description BINDING SITE FOR RESIDUE NO3 A 904 source : AC6 26) chain A residue 213 type sequence I description BINDING SITE FOR RESIDUE NO3 A 904 source : AC6 27) chain A residue 214 type sequence G description BINDING SITE FOR RESIDUE NO3 A 904 source : AC6 28) chain A residue 220 type sequence I description BINDING SITE FOR RESIDUE NO3 A 905 source : AC7 29) chain A residue 184 type sequence D description BINDING SITE FOR RESIDUE NO3 A 906 source : AC8 30) chain A residue 186 type sequence Y description BINDING SITE FOR RESIDUE NO3 A 906 source : AC8 31) chain A residue 188 type sequence R description BINDING SITE FOR RESIDUE NO3 A 906 source : AC8 32) chain A residue 244 type sequence T description BINDING SITE FOR RESIDUE NO3 A 906 source : AC8 33) chain A residue 104 type sequence Y description BINDING SITE FOR RESIDUE NO3 A 907 source : AC9 34) chain A residue 105 type sequence S description BINDING SITE FOR RESIDUE NO3 A 907 source : AC9 35) chain A residue 108 type sequence I description BINDING SITE FOR RESIDUE NO3 A 907 source : AC9 36) chain A residue 140 type sequence S description BINDING SITE FOR RESIDUE NO3 A 907 source : AC9 37) chain A residue 191 type sequence S description BINDING SITE FOR RESIDUE NO3 A 908 source : BC1 38) chain A residue 246 type sequence A description BINDING SITE FOR RESIDUE NO3 A 908 source : BC1 39) chain A residue 247 type sequence S description BINDING SITE FOR RESIDUE NO3 A 908 source : BC1 40) chain A residue 250 type sequence R description BINDING SITE FOR RESIDUE NO3 A 908 source : BC1 41) chain A residue 39 type ACT_SITE sequence D description Charge relay system => ECO:0000255|PROSITE-ProRule:PRU01240 source Swiss-Prot : SWS_FT_FI1 42) chain A residue 69 type ACT_SITE sequence H description Charge relay system => ECO:0000255|PROSITE-ProRule:PRU01240 source Swiss-Prot : SWS_FT_FI1 43) chain A residue 224 type ACT_SITE sequence S description Charge relay system => ECO:0000255|PROSITE-ProRule:PRU01240 source Swiss-Prot : SWS_FT_FI1 44) chain A residue 35-46 type prosite sequence VYVIDTGIEASH description SUBTILASE_ASP Serine proteases, subtilase family, aspartic acid active site. VYVIDTGIeasH source prosite : PS00136 45) chain A residue 69-79 type prosite sequence HGTHCAGTVGS description SUBTILASE_HIS Serine proteases, subtilase family, histidine active site. HGThCAGtVGS source prosite : PS00137 46) chain A residue 222-232 type prosite sequence GTSMATPHVAG description SUBTILASE_SER Serine proteases, subtilase family, serine active site. GTSmAtPhVAG source prosite : PS00138 47) chain A residue 175 type BINDING sequence P description source Swiss-Prot : SWS_FT_FI2 48) chain A residue 177 type BINDING sequence V description source Swiss-Prot : SWS_FT_FI2 49) chain A residue 200 type BINDING sequence D description source Swiss-Prot : SWS_FT_FI2 50) chain A residue 260 type BINDING sequence D description source Swiss-Prot : SWS_FT_FI2 51) chain A residue 16 type BINDING sequence T description source Swiss-Prot : SWS_FT_FI2

Display surface Download Links