eF-site ID 1ib7_8-A PDB Code 1ib7 Model 8 Chain A click to enlarge Title SOLUTION STRUCTURE OF F35Y MUTANT OF RAT FERRO CYTOCHROME B5, A CONFORMATION, ENSEMBLE OF 20 STRUCTURES Classification ELECTRON TRANSPORT Compound CYTOCHROME B5 Source null (CYB5_RAT) Sequence A:  VKYYTLEEIQKHKDSKSTWVILHHKVYDLTKYLEEHPGGE EVLREQAGGDATENFEDVGHSTDARELSKTYIIGELHPDD RSKIA Description Functional site 1) chain A residue 30 type sequence Y description BINDING SITE FOR RESIDUE HEM A 95 source : AC1 2) chain A residue 32 type sequence L description BINDING SITE FOR RESIDUE HEM A 95 source : AC1 3) chain A residue 35 type sequence Y description BINDING SITE FOR RESIDUE HEM A 95 source : AC1 4) chain A residue 39 type sequence H description BINDING SITE FOR RESIDUE HEM A 95 source : AC1 5) chain A residue 45 type sequence V description BINDING SITE FOR RESIDUE HEM A 95 source : AC1 6) chain A residue 46 type sequence L description BINDING SITE FOR RESIDUE HEM A 95 source : AC1 7) chain A residue 54 type sequence A description BINDING SITE FOR RESIDUE HEM A 95 source : AC1 8) chain A residue 58 type sequence F description BINDING SITE FOR RESIDUE HEM A 95 source : AC1 9) chain A residue 61 type sequence V description BINDING SITE FOR RESIDUE HEM A 95 source : AC1 10) chain A residue 62 type sequence G description BINDING SITE FOR RESIDUE HEM A 95 source : AC1 11) chain A residue 63 type sequence H description BINDING SITE FOR RESIDUE HEM A 95 source : AC1 12) chain A residue 64 type sequence S description BINDING SITE FOR RESIDUE HEM A 95 source : AC1 13) chain A residue 66 type sequence D description BINDING SITE FOR RESIDUE HEM A 95 source : AC1 14) chain A residue 67 type sequence A description BINDING SITE FOR RESIDUE HEM A 95 source : AC1 15) chain A residue 70 type sequence L description BINDING SITE FOR RESIDUE HEM A 95 source : AC1 16) chain A residue 71 type sequence S description BINDING SITE FOR RESIDUE HEM A 95 source : AC1 17) chain A residue 6 type MOD_RES sequence Y description N6-acetyllysine => ECO:0000250|UniProtKB:P56395 source Swiss-Prot : SWS_FT_FI2 18) chain A residue 15 type MOD_RES sequence H description N6-acetyllysine => ECO:0000250|UniProtKB:P56395 source Swiss-Prot : SWS_FT_FI2 19) chain A residue 35-42 type prosite sequence YLEEHPGG description CYTOCHROME_B5_1 Cytochrome b5 family, heme-binding domain signature. YLEEHPGG source prosite : PS00191 20) chain A residue 40 type BINDING sequence P description axial binding residue source Swiss-Prot : SWS_FT_FI1 21) chain A residue 64 type BINDING sequence S description axial binding residue source Swiss-Prot : SWS_FT_FI1

Display surface Download Links