eF-site ID 1i94-R PDB Code 1i94 Chain R click to enlarge Title CRYSTAL STRUCTURES OF THE SMALL RIBOSOMAL SUBUNIT WITH TETRACYCLINE, EDEINE AND IF3 Classification RIBOSOME Compound 16S RRNA Source ORGANISM_SCIENTIFIC: Thermus thermophilus; Sequence R:  KPKKEAQRRPSRKAKVKATLGEFDLRDYRNVEVLKRFLSE TGKILPRRRTGLSGKEQRILAKTIKRARILGLLPFTEKLV RK Description Functional site 1) chain R residue 45 type sequence S description BINDING SITE FOR RESIDUE WO2 R 1008 source : HC5 2) chain R residue 46 type sequence E description BINDING SITE FOR RESIDUE WO2 R 1008 source : HC5 3) chain R residue 49 type sequence K description BINDING SITE FOR RESIDUE WO2 R 1008 source : HC5 4) chain R residue 50 type sequence I description BINDING SITE FOR RESIDUE WO2 R 1008 source : HC5 5) chain R residue 51 type sequence L description BINDING SITE FOR RESIDUE WO2 R 1008 source : HC5 6) chain R residue 32-55 type prosite sequence RDYRNVEVLKRFLSETGKILPRRR description RIBOSOMAL_S18 Ribosomal protein S18 signature. RDYrn.VevLkrFLSEt.GKIlprRR source prosite : PS00057 7) chain R residue 66-81 type prosite sequence LAKTIKRARILGLLPF description ALDOKETO_REDUCTASE_3 Aldo/keto reductase family putative active site signature. LAKTIKraRIlGLlPF source prosite : PS00063

Display surface Download Links