eF-site ID 1i94-N PDB Code 1i94 Chain N click to enlarge Title CRYSTAL STRUCTURES OF THE SMALL RIBOSOMAL SUBUNIT WITH TETRACYCLINE, EDEINE AND IF3 Classification RIBOSOME Compound 16S RRNA Source ORGANISM_SCIENTIFIC: Thermus thermophilus; Sequence N:  ARKALIEKAKRTPKFKVRAYTRCVRCGRARSVYRFFGLCR ICLRELAHKGQLPGVRKASW Description Functional site 1) chain N residue 24 type sequence C description BINDING SITE FOR RESIDUE ZN N 76 source : GC5 2) chain N residue 27 type sequence C description BINDING SITE FOR RESIDUE ZN N 76 source : GC5 3) chain N residue 40 type sequence C description BINDING SITE FOR RESIDUE ZN N 76 source : GC5 4) chain N residue 43 type sequence C description BINDING SITE FOR RESIDUE ZN N 76 source : GC5 5) chain N residue 25 type BINDING sequence V description BINDING => ECO:0000255|HAMAP-Rule:MF_01364 source Swiss-Prot : SWS_FT_FI1 6) chain N residue 28 type BINDING sequence G description BINDING => ECO:0000255|HAMAP-Rule:MF_01364 source Swiss-Prot : SWS_FT_FI1 7) chain N residue 41 type BINDING sequence R description BINDING => ECO:0000255|HAMAP-Rule:MF_01364 source Swiss-Prot : SWS_FT_FI1 8) chain N residue 44 type BINDING sequence L description BINDING => ECO:0000255|HAMAP-Rule:MF_01364 source Swiss-Prot : SWS_FT_FI1 9) chain N residue 24 type BINDING sequence C description BINDING => ECO:0000269|PubMed:11866529 source Swiss-Prot : SWS_FT_FI2 10) chain N residue 27 type BINDING sequence C description BINDING => ECO:0000269|PubMed:11866529 source Swiss-Prot : SWS_FT_FI2 11) chain N residue 40 type BINDING sequence C description BINDING => ECO:0000269|PubMed:11866529 source Swiss-Prot : SWS_FT_FI2 12) chain N residue 43 type BINDING sequence C description BINDING => ECO:0000269|PubMed:11866529 source Swiss-Prot : SWS_FT_FI2 13) chain N residue 23-45 type prosite sequence RCVRCGRARSVYRFFGLCRICLR description RIBOSOMAL_S14 Ribosomal protein S14 signature. R.CvrcgrarsvyrfFGLCRiCLR source prosite : PS00527

Display surface Download Links