eF-site ID 1i7h-C PDB Code 1i7h Chain C click to enlarge Title CRYSTAL STURCUTURE OF FDX Classification ELECTRON TRANSPORT Compound FERREDOXIN Source null (FER_ECOLI) Sequence C:  PKIVILPHQDLCPDGAVLEANSGETILDAALRNGIEIEHA CEKSCACTTCHCIVREGFDSLPESSEQEDDMLDKAWGLEP ESRLSCQARVTDEDLVVEIPRYTINHAR Description Functional site 1) chain C residue 40 type sequence H description BINDING SITE FOR RESIDUE FES C 3112 source : AC3 2) chain C residue 42 type sequence C description BINDING SITE FOR RESIDUE FES C 3112 source : AC3 3) chain C residue 44 type sequence K description BINDING SITE FOR RESIDUE FES C 3112 source : AC3 4) chain C residue 46 type sequence C description BINDING SITE FOR RESIDUE FES C 3112 source : AC3 5) chain C residue 48 type sequence C description BINDING SITE FOR RESIDUE FES C 3112 source : AC3 6) chain C residue 51 type sequence C description BINDING SITE FOR RESIDUE FES C 3112 source : AC3 7) chain C residue 87 type sequence C description BINDING SITE FOR RESIDUE FES C 3112 source : AC3 8) chain C residue 42 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 9) chain C residue 48 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 10) chain C residue 51 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 11) chain C residue 87 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1

Display surface Download Links