eF-site ID 1i7h-A PDB Code 1i7h Chain A click to enlarge Title CRYSTAL STURCUTURE OF FDX Classification ELECTRON TRANSPORT Compound FERREDOXIN Source Escherichia coli (strain K12) (FER_ECOLI) Sequence A:  PKIVILPHQDLCPDGAVLEANSGETILDAALRNGIEIEHA CEKSCACTTCHCIVREGFDSLPESSEQEDDMLDKAWGLEP ESRLSCQARVTDEDLVVEIPRYTINHARE Description Functional site 1) chain A residue 40 type sequence H description BINDING SITE FOR RESIDUE FES A 1112 source : AC1 2) chain A residue 42 type sequence C description BINDING SITE FOR RESIDUE FES A 1112 source : AC1 3) chain A residue 44 type sequence K description BINDING SITE FOR RESIDUE FES A 1112 source : AC1 4) chain A residue 46 type sequence C description BINDING SITE FOR RESIDUE FES A 1112 source : AC1 5) chain A residue 47 type sequence A description BINDING SITE FOR RESIDUE FES A 1112 source : AC1 6) chain A residue 48 type sequence C description BINDING SITE FOR RESIDUE FES A 1112 source : AC1 7) chain A residue 51 type sequence C description BINDING SITE FOR RESIDUE FES A 1112 source : AC1 8) chain A residue 87 type sequence C description BINDING SITE FOR RESIDUE FES A 1112 source : AC1 9) chain A residue 42-52 type prosite sequence CEKSCACTTCH description ADX Adrenodoxin family, iron-sulfur binding region signature. CekScACTTCH source prosite : PS00814 10) chain A residue 42 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 11) chain A residue 48 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 12) chain A residue 51 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 13) chain A residue 87 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1

Display surface Download Links