eF-site ID 1hr0-Q
PDB Code 1hr0
Chain Q

click to enlarge
Title CRYSTAL STRUCTURE OF INITIATION FACTOR IF1 BOUND TO THE 30S RIBOSOMAL SUBUNIT
Classification RIBOSOME
Compound 16S RIBOSOMAL RNA
Source ORGANISM_SCIENTIFIC: Thermus thermophilus;
Sequence Q:  PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKK
YLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGR
MDLVEKYLIRRQNYQSLSKRGGKA
Description (1)  30S RIBOSOMAL SUBUNIT, INITIATION FACTOR 1

Display surface

Download
Links